| Identification | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Name | Efalizumab | ||||||||||||
| Accession Number | DB00095 (BIOD00074, BTD00074) | ||||||||||||
| Type | biotech | ||||||||||||
| Groups | approved | ||||||||||||
| Description | Humanized IgG1 kappa isotype monoclonal antibody that binds to human CD11a. Efalizumab has a molecular weight of approximately 150 kilodaltons and is produced in a Chinese hamster ovary mammalian cell expression system in a nutrient medium containing the antibiotic gentamicin. |
||||||||||||
| Protein structure |
Display: 3D Structure |
||||||||||||
| Protein chemical formula | Not Available | ||||||||||||
| Protein average weight | Not Available | ||||||||||||
| Sequences |
>Heavy Chain Variable Region EVQLVESGGGLVQPGGSLRLSCAASGYSFTGHWMNWVRQAPGKGLEWVGIMIHPSDSETR YNQKFKDIRFTISVDKSKNTLYLQMNSLRAEDTAVYYCARIGIYFYGTTYFDYIWGQGTL VTVSS >Light Chain Variable Region DIQMTQSPSSLSASVGDRVTITCRASKTISKYLAWXQQKPGKAPKLLIYSGSTLQSGVPS RFSGSGSGTDFTLTISSLQPEDFATYYCQQHNEYPLTFGQGTKVEIKR FASTA |
||||||||||||
| Synonyms |
|
||||||||||||
| Brand names |
|
||||||||||||
| Brand name mixtures | Not Available | ||||||||||||
| Categories |
|
||||||||||||
| CAS number | 214745-43-4 | ||||||||||||
| Taxonomy | |||||||||||||
| Kingdom | Not Available | ||||||||||||
| Classes | Not Available | ||||||||||||
| Substructures | Not Available | ||||||||||||
| Pharmacology | |||||||||||||
| Indication | For the treatment of adult patients with moderate to severe chronic plaque psoriasis, who are candidates for phototherapy or systemic therapy. | ||||||||||||
| Pharmacodynamics | Lymphocyte activation and trafficking to skin play a role in the pathophysiology of chronic plaque psoriasis. In psoriatic skin, ICAM-1 cell surface expression is upregulated on endothelium and keratinocytes. Raptiva inhibits the binding of LFA-1 to the intercellular adhesion molecule-1 (ICAM-1), thereby inhibiting the adhesion of leukocytes to other cell types. | ||||||||||||
| Mechanism of action | Efalizumab binds to CD11a, a subunit of leukocyte function antigen-1 (LFA-1), which is expressed on all leukocytes. As a result efalizumab decreases cell surface expression of CD11a. | ||||||||||||
| Absorption | Average efalizumab bioavailability following subcutaneous administration was estimated at 30 to 50%. | ||||||||||||
| Volume of distribution | Not Available | ||||||||||||
| Protein binding | Not Available | ||||||||||||
| Metabolism | |||||||||||||
| Route of elimination | Not Available | ||||||||||||
| Half life | 5 days | ||||||||||||
| Clearance | Not Available | ||||||||||||
| Toxicity | Not Available | ||||||||||||
| Affected organisms |
|
||||||||||||
| Pathways | Not Available | ||||||||||||
| Pharmacoeconomics | |||||||||||||
| Manufacturers | Not Available | ||||||||||||
| Packagers | |||||||||||||
| Dosage forms |
|
||||||||||||
| Prices | Not Available | ||||||||||||
| Patents | Not Available | ||||||||||||
| Properties | |||||||||||||
| State | liquid | ||||||||||||
| Melting point | 61 oC (FAB fragment), 71 oC (whole mAb)-Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000). | ||||||||||||
| Experimental Properties | Not Available | ||||||||||||
| References | |||||||||||||
| Synthesis Reference | Not Available | ||||||||||||
| General Reference | |||||||||||||
| External Links |
|
||||||||||||
| ATC Codes |
|
||||||||||||
| AHFS Codes |
|
||||||||||||
| PDB Entries | |||||||||||||
| FDA label | show (1.4 MB) | ||||||||||||
| MSDS | Not Available | ||||||||||||
| Interactions | |||||||||||||
| Drug Interactions | Not Available | ||||||||||||
| Food Interactions | Not Available | ||||||||||||
| Targets |
|---|
|
Pharmacological action: yes
Actions: antibody Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. It is involved in a variety of immune phenomena including leukocyte-endothelial cell interaction, cytotoxic T-cell mediated killing, and antibody dependent killing by granulocytes and monocytes Organism class: humanUniProt ID: P20701 ![]() Gene: ITGAL ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References:
2. Low affinity immunoglobulin gamma Fc region receptor III-B Pharmacological action: unknownReceptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils Organism class: humanUniProt ID: O75015 ![]() Gene: FCGR3B ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References: 3. Complement C1r subcomponent Pharmacological action: unknownC1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system Organism class: humanUniProt ID: P00736 ![]() Gene: C1R ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References: 4. Complement C1q subcomponent subunit A Pharmacological action: unknownC1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes Organism class: humanUniProt ID: P02745 ![]() Gene: C1QA ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References: 5. Complement C1q subcomponent subunit B Pharmacological action: unknownC1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes Organism class: humanUniProt ID: P02746 ![]() Gene: C1QB ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References: 6. Complement C1q subcomponent subunit C Pharmacological action: unknownC1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes Organism class: humanUniProt ID: P02747 ![]() Gene: C1QC ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References: 7. Low affinity immunoglobulin gamma Fc region receptor III-A Pharmacological action: unknownReceptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis Organism class: humanUniProt ID: P08637 ![]() Gene: FCGR3A ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References: 8. High affinity immunoglobulin gamma Fc receptor I Pharmacological action: unknownBinds to the Fc region of immunoglobulins gamma. High affinity receptor Organism class: humanUniProt ID: P12314 ![]() Gene: FCGR1A ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References: 9. Low affinity immunoglobulin gamma Fc region receptor II-a Pharmacological action: unknownBinds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens Organism class: humanUniProt ID: P12318 ![]() Gene: FCGR2A ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References: 10. Low affinity immunoglobulin gamma Fc region receptor II-b Pharmacological action: unknownReceptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B- cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells (TCR) or via another Fc receptor. Isoform IIB1 fails to mediate endocytosis or phagocytosis. Isoform IIB2 does not trigger phagocytosis Organism class: humanUniProt ID: P31994 ![]() Gene: FCGR2B ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References: 11. Low affinity immunoglobulin gamma Fc region receptor II-c Pharmacological action: unknownReceptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells Organism class: humanUniProt ID: P31995 ![]() Gene: FCGR2C ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References: |
| Comments |
|---|
This project is supported by Genome Alberta & Genome Canada, a not-for-profit organization that is leading Canada's national genomics strategy with $600 million in funding from the federal government. This project is also supported in part by GenomeQuest, Inc., an enterprise genomic information company serving the life science community.