You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameBecaplermin
Accession NumberDB00102  (BTD00053, BIOD00053)
TypeBiotech
GroupsApproved, Investigational
DescriptionBecaplermin is produced by recombinant DNA technology by insertion of the gene for the B chain of platelet derived growth factor (PDGF) into the yeast, Saccharomyces cerevisiae. Becaplermin has a molecular weight of approximately 25 KD and is a homodimer composed of two identical polypeptide chains that are bound together by disulfide bonds.
Protein structureDb00102
Related Articles
Protein chemical formulaC532H892N162O153S9
Protein average weight12294.4 Da
Sequences
>DB00102 sequence
SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQC
RPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Download FASTA Format
Synonyms
c-sis
PDGF B-chain
PDGF-2
PDGF-BB
PDGFB
Platelet-derived growth factor B chain precursor
Platelet-derived growth factor beta polypeptide
SH-POLYPEPTIDE-59
External Identifiers
  • RWJ-60235
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Regranexgel100 ug/gtopicalHEALTHPOINT, LTD2011-11-012016-01-31Us
Regranexgel100 ug/gtopicalSmith & Nephew, Inc.2011-11-01Not applicableUs
Regranex (becaplermin) 0.01%gel100 mcgtopicalJanssen Inc1999-02-012011-07-27Canada
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
RegranexGel0.01 %Cutaneous useJanssen Cilag International Nv1999-03-29Not applicableEu
International BrandsNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNII1B56C968OA
CAS number165101-51-9
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationFor topical treatment of skin ulcers (from diabetes)
PharmacodynamicsUsed for the topical treatment of skin ulcers, Regranex has a biological activity similar to that of endogenous platelet-derived growth factor, which includes promoting the chemotactic recruitment and proliferation of cells involved in wound repair and enhancing the formation of granulation tissue.
Mechanism of actionBinds to the beta platelet-derived growth factor (PDGF) receptor, a tyrosine kinase receptor. PDGF is known to exist as a dimer, and activates its signaling pathway by a ligand induced receptor dimerization and autophosphorylation. PDGF receptors also contain many auto-phosphorylation sites, which serve to mediate binding of SH2 sites and subsequently signal corresponding pathways. There are five different isoforms of PDGF that activate through two different receptors (alpha and beta).
Related Articles
Absorptionvery little systemic absorption. 15% of patients experienced complete healing within 8 weeks, while for 25% of patients, it was at 10 weeks.
Volume of distributionNot Available
Protein bindingNot Available
MetabolismNot Available
Route of eliminationNot Available
Half lifeNot Available
ClearanceNot Available
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
GelCutaneous use0.01 %
Geltopical100 ug/g
Geltopical100 mcg
Prices
Unit descriptionCostUnit
Regranex 0.01% Gel 15 gm Tube723.82USD tube
Regranex 0.01% gel46.4USD g
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1340846 No1999-12-072015-12-15Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.160Not Available
isoelectric point9.38Not Available
References
Synthesis ReferenceNot Available
General References
  1. Link [Link]
  2. Link [Link]
External Links
ATC CodesA01AD08D03AX06
AHFS Codes
  • 84:16.00
PDB Entries
FDA labelDownload (248 KB)
MSDSNot Available
Interactions
Drug Interactions
Drug
AbciximabAbciximab may increase the anticoagulant activities of Becaplermin.
AceclofenacAceclofenac may increase the anticoagulant activities of Becaplermin.
AcenocoumarolBecaplermin may increase the anticoagulant activities of Acenocoumarol.
Acetylsalicylic acidAcetylsalicylic acid may increase the anticoagulant activities of Becaplermin.
AdapaleneAdapalene may increase the anticoagulant activities of Becaplermin.
AllylestrenolThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Allylestrenol.
AlprostadilAlprostadil may increase the anticoagulant activities of Becaplermin.
AlteplaseAlteplase may increase the anticoagulant activities of Becaplermin.
AltrenogestThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Altrenogest.
ALX-0081ALX-0081 may increase the anticoagulant activities of Becaplermin.
Aminosalicylic AcidAminosalicylic Acid may increase the anticoagulant activities of Becaplermin.
AnagrelideAnagrelide may increase the anticoagulant activities of Becaplermin.
AncrodBecaplermin may increase the anticoagulant activities of Ancrod.
AnistreplaseAnistreplase may increase the anticoagulant activities of Becaplermin.
AntipyrineAntipyrine may increase the anticoagulant activities of Becaplermin.
Antithrombin III humanBecaplermin may increase the anticoagulant activities of Antithrombin III human.
ApixabanApixaban may increase the anticoagulant activities of Becaplermin.
ApremilastApremilast may increase the anticoagulant activities of Becaplermin.
ArdeparinBecaplermin may increase the anticoagulant activities of Ardeparin.
ArgatrobanBecaplermin may increase the anticoagulant activities of Argatroban.
AstaxanthinAstaxanthin may increase the anticoagulant activities of Becaplermin.
AzapropazoneAzapropazone may increase the anticoagulant activities of Becaplermin.
AzelastineAzelastine may increase the anticoagulant activities of Becaplermin.
BalsalazideBalsalazide may increase the anticoagulant activities of Becaplermin.
BatroxobinBatroxobin may increase the anticoagulant activities of Becaplermin.
BazedoxifeneBazedoxifene may decrease the anticoagulant activities of Becaplermin.
BemiparinBemiparin may increase the anticoagulant activities of Becaplermin.
BenoxaprofenBenoxaprofen may increase the anticoagulant activities of Becaplermin.
BeraprostBeraprost may increase the anticoagulant activities of Becaplermin.
BivalirudinBivalirudin may increase the anticoagulant activities of Becaplermin.
BromfenacBromfenac may increase the anticoagulant activities of Becaplermin.
CangrelorCangrelor may increase the anticoagulant activities of Becaplermin.
CarprofenCarprofen may increase the anticoagulant activities of Becaplermin.
CastanospermineCastanospermine may increase the anticoagulant activities of Becaplermin.
CelecoxibCelecoxib may increase the anticoagulant activities of Becaplermin.
CertoparinBecaplermin may increase the anticoagulant activities of Certoparin.
ChloroquineChloroquine may increase the anticoagulant activities of Becaplermin.
ChlorotrianiseneChlorotrianisene may decrease the anticoagulant activities of Becaplermin.
CilostazolCilostazol may increase the anticoagulant activities of Becaplermin.
Citric AcidBecaplermin may increase the anticoagulant activities of Citric Acid.
ClonixinClonixin may increase the anticoagulant activities of Becaplermin.
ClopidogrelClopidogrel may increase the anticoagulant activities of Becaplermin.
CollagenaseThe risk or severity of adverse effects can be increased when Becaplermin is combined with Collagenase.
Conjugated Equine EstrogensConjugated Equine Estrogens may decrease the anticoagulant activities of Becaplermin.
D-LimoneneD-Limonene may increase the anticoagulant activities of Becaplermin.
Dabigatran etexilateDabigatran etexilate may increase the anticoagulant activities of Becaplermin.
DalteparinBecaplermin may increase the anticoagulant activities of Dalteparin.
DanaparoidBecaplermin may increase the anticoagulant activities of Danaparoid.
DasatinibDasatinib may increase the anticoagulant activities of Becaplermin.
DeferasiroxThe risk or severity of adverse effects can be increased when Becaplermin is combined with Deferasirox.
DefibrotideDefibrotide may increase the anticoagulant activities of Becaplermin.
Deoxycholic AcidThe risk or severity of adverse effects can be increased when Becaplermin is combined with Deoxycholic Acid.
DesirudinBecaplermin may increase the anticoagulant activities of Desirudin.
DesmoteplaseDesmoteplase may increase the anticoagulant activities of Becaplermin.
DesogestrelThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Desogestrel.
DextranBecaplermin may increase the anticoagulant activities of Dextran.
Dextran 40Becaplermin may increase the anticoagulant activities of Dextran 40.
Dextran 70Becaplermin may increase the anticoagulant activities of Dextran 70.
Dextran 75Becaplermin may increase the anticoagulant activities of Dextran 75.
DiclofenacDiclofenac may increase the anticoagulant activities of Becaplermin.
DicoumarolBecaplermin may increase the anticoagulant activities of Dicoumarol.
DienestrolDienestrol may decrease the anticoagulant activities of Becaplermin.
DienogestThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Dienogest.
DiethylstilbestrolDiethylstilbestrol may decrease the anticoagulant activities of Becaplermin.
DiflunisalDiflunisal may increase the anticoagulant activities of Becaplermin.
DipyridamoleDipyridamole may increase the anticoagulant activities of Becaplermin.
DitazoleDitazole may increase the anticoagulant activities of Becaplermin.
DrospirenoneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Drospirenone.
Drotrecogin alfaDrotrecogin alfa may increase the anticoagulant activities of Becaplermin.
DroxicamDroxicam may increase the anticoagulant activities of Becaplermin.
DydrogesteroneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Dydrogesterone.
Edetic AcidBecaplermin may increase the anticoagulant activities of Edetic Acid.
EdoxabanEdoxaban may increase the anticoagulant activities of Becaplermin.
EnoxaparinBecaplermin may increase the anticoagulant activities of Enoxaparin.
EpinastineEpinastine may increase the anticoagulant activities of Becaplermin.
EpirizoleEpirizole may increase the anticoagulant activities of Becaplermin.
EpoprostenolEpoprostenol may increase the anticoagulant activities of Becaplermin.
EptifibatideEptifibatide may increase the anticoagulant activities of Becaplermin.
EstradiolEstradiol may decrease the anticoagulant activities of Becaplermin.
EstriolEstriol may decrease the anticoagulant activities of Becaplermin.
EstroneEstrone may decrease the anticoagulant activities of Becaplermin.
EtanerceptEtanercept may increase the anticoagulant activities of Becaplermin.
Ethinyl EstradiolEthinyl Estradiol may decrease the anticoagulant activities of Becaplermin.
Ethyl biscoumacetateBecaplermin may increase the anticoagulant activities of Ethyl biscoumacetate.
EtodolacEtodolac may increase the anticoagulant activities of Becaplermin.
EtofenamateEtofenamate may increase the anticoagulant activities of Becaplermin.
EtonogestrelThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Etonogestrel.
EtoricoxibEtoricoxib may increase the anticoagulant activities of Becaplermin.
Evening primrose oilEvening primrose oil may increase the anticoagulant activities of Becaplermin.
exisulindexisulind may increase the anticoagulant activities of Becaplermin.
FenbufenFenbufen may increase the anticoagulant activities of Becaplermin.
FenoprofenFenoprofen may increase the anticoagulant activities of Becaplermin.
FibrinolysinFibrinolysin may increase the anticoagulant activities of Becaplermin.
FloctafenineFloctafenine may increase the anticoagulant activities of Becaplermin.
FlunixinFlunixin may increase the anticoagulant activities of Becaplermin.
FlurbiprofenFlurbiprofen may increase the anticoagulant activities of Becaplermin.
Fondaparinux sodiumBecaplermin may increase the anticoagulant activities of Fondaparinux sodium.
GenisteinGenistein may decrease the anticoagulant activities of Becaplermin.
GestodeneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Gestodene.
HeminHemin may increase the anticoagulant activities of Becaplermin.
HeparinBecaplermin may increase the anticoagulant activities of Heparin.
HexestrolHexestrol may decrease the anticoagulant activities of Becaplermin.
HirulogBecaplermin may increase the anticoagulant activities of Hirulog.
HMPL-004HMPL-004 may increase the anticoagulant activities of Becaplermin.
Hydroxyprogesterone caproateThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Hydroxyprogesterone caproate.
Ibritumomab tiuxetanThe risk or severity of adverse effects can be increased when Becaplermin is combined with Ibritumomab tiuxetan.
IbrutinibThe risk or severity of adverse effects can be increased when Ibrutinib is combined with Becaplermin.
IbudilastIbudilast may increase the anticoagulant activities of Becaplermin.
IbuprofenIbuprofen may increase the anticoagulant activities of Becaplermin.
IbuproxamIbuproxam may increase the anticoagulant activities of Becaplermin.
IcatibantIcatibant may increase the anticoagulant activities of Becaplermin.
Icosapent ethylIcosapent ethyl may increase the anticoagulant activities of Becaplermin.
IfenprodilIfenprodil may increase the anticoagulant activities of Becaplermin.
IloprostIloprost may increase the anticoagulant activities of Becaplermin.
IndomethacinIndomethacin may increase the anticoagulant activities of Becaplermin.
IndoprofenIndoprofen may increase the anticoagulant activities of Becaplermin.
IsoxicamIsoxicam may increase the anticoagulant activities of Becaplermin.
KebuzoneKebuzone may increase the anticoagulant activities of Becaplermin.
KetoprofenKetoprofen may increase the anticoagulant activities of Becaplermin.
KetorolacKetorolac may increase the anticoagulant activities of Becaplermin.
LeflunomideLeflunomide may increase the anticoagulant activities of Becaplermin.
LepirudinLepirudin may increase the anticoagulant activities of Becaplermin.
LevonorgestrelThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Levonorgestrel.
LimaprostThe risk or severity of adverse effects can be increased when Limaprost is combined with Becaplermin.
LornoxicamLornoxicam may increase the anticoagulant activities of Becaplermin.
LoxoprofenLoxoprofen may increase the anticoagulant activities of Becaplermin.
LumiracoxibLumiracoxib may increase the anticoagulant activities of Becaplermin.
Magnesium salicylateMagnesium salicylate may increase the anticoagulant activities of Becaplermin.
MasoprocolMasoprocol may increase the anticoagulant activities of Becaplermin.
Meclofenamic acidMeclofenamic acid may increase the anticoagulant activities of Becaplermin.
MedrogestoneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Medrogestone.
Medroxyprogesterone acetateThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Medroxyprogesterone acetate.
Mefenamic acidMefenamic acid may increase the anticoagulant activities of Becaplermin.
Megestrol acetateThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Megestrol acetate.
MeloxicamMeloxicam may increase the anticoagulant activities of Becaplermin.
MesalazineMesalazine may increase the anticoagulant activities of Becaplermin.
MestranolMestranol may decrease the anticoagulant activities of Becaplermin.
MetamizoleMetamizole may increase the anticoagulant activities of Becaplermin.
MilrinoneMilrinone may increase the anticoagulant activities of Becaplermin.
Mycophenolate mofetilMycophenolate mofetil may increase the anticoagulant activities of Becaplermin.
Mycophenolic acidMycophenolic acid may increase the anticoagulant activities of Becaplermin.
NabumetoneNabumetone may increase the anticoagulant activities of Becaplermin.
NadroparinBecaplermin may increase the anticoagulant activities of Nadroparin.
NaftifineNaftifine may increase the anticoagulant activities of Becaplermin.
NaproxenNaproxen may increase the anticoagulant activities of Becaplermin.
NCX 4016NCX 4016 may increase the anticoagulant activities of Becaplermin.
NepafenacNepafenac may increase the anticoagulant activities of Becaplermin.
Niflumic AcidNiflumic Acid may increase the anticoagulant activities of Becaplermin.
NimesulideNimesulide may increase the anticoagulant activities of Becaplermin.
NintedanibThe risk or severity of adverse effects can be increased when Becaplermin is combined with Nintedanib.
NorethisteroneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Norethisterone.
ObinutuzumabThe risk or severity of adverse effects can be increased when Becaplermin is combined with Obinutuzumab.
OlopatadineOlopatadine may increase the anticoagulant activities of Becaplermin.
OlsalazineOlsalazine may increase the anticoagulant activities of Becaplermin.
Omacetaxine mepesuccinateThe risk or severity of adverse effects can be increased when Becaplermin is combined with Omacetaxine mepesuccinate.
Omega-3 fatty acidsOmega-3 fatty acids may increase the anticoagulant activities of Becaplermin.
OrgoteinOrgotein may increase the anticoagulant activities of Becaplermin.
OtamixabanBecaplermin may increase the anticoagulant activities of Otamixaban.
OxaprozinOxaprozin may increase the anticoagulant activities of Becaplermin.
OxyphenbutazoneOxyphenbutazone may increase the anticoagulant activities of Becaplermin.
ParecoxibParecoxib may increase the anticoagulant activities of Becaplermin.
ParnaparinParnaparin may increase the anticoagulant activities of Becaplermin.
Pentosan PolysulfatePentosan Polysulfate may increase the anticoagulant activities of Becaplermin.
PentoxifyllinePentoxifylline may increase the anticoagulant activities of Becaplermin.
PhenindioneBecaplermin may increase the anticoagulant activities of Phenindione.
PhenprocoumonBecaplermin may increase the anticoagulant activities of Phenprocoumon.
PhenylbutazonePhenylbutazone may increase the anticoagulant activities of Becaplermin.
PimecrolimusPimecrolimus may increase the anticoagulant activities of Becaplermin.
PirfenidonePirfenidone may increase the anticoagulant activities of Becaplermin.
PiroxicamPiroxicam may increase the anticoagulant activities of Becaplermin.
PlasminPlasmin may increase the anticoagulant activities of Becaplermin.
Polyestradiol phosphatePolyestradiol phosphate may decrease the anticoagulant activities of Becaplermin.
PrasugrelPrasugrel may increase the anticoagulant activities of Becaplermin.
ProgesteroneThe therapeutic efficacy of Becaplermin can be decreased when used in combination with Progesterone.
PropacetamolPropacetamol may increase the anticoagulant activities of Becaplermin.
Protein CBecaplermin may increase the anticoagulant activities of Protein C.
ProtocatechualdehydeBecaplermin may increase the anticoagulant activities of Protocatechualdehyde.
PTC299PTC299 may increase the anticoagulant activities of Becaplermin.
QuinestrolQuinestrol may decrease the anticoagulant activities of Becaplermin.
ResveratrolResveratrol may increase the anticoagulant activities of Becaplermin.
ReteplaseReteplase may increase the anticoagulant activities of Becaplermin.
ReviparinBecaplermin may increase the anticoagulant activities of Reviparin.
RidogrelRidogrel may increase the anticoagulant activities of Becaplermin.
RivaroxabanBecaplermin may increase the anticoagulant activities of Rivaroxaban.
RofecoxibRofecoxib may increase the anticoagulant activities of Becaplermin.
RosiglitazoneRosiglitazone may increase the anticoagulant activities of Becaplermin.
SalicylamideSalicylamide may increase the anticoagulant activities of Becaplermin.
Salicylic acidSalicylic acid may increase the anticoagulant activities of Becaplermin.
SalsalateSalsalate may increase the anticoagulant activities of Becaplermin.
SCH-530348SCH-530348 may increase the anticoagulant activities of Becaplermin.
SelexipagSelexipag may increase the anticoagulant activities of Becaplermin.
SeratrodastSeratrodast may increase the anticoagulant activities of Becaplermin.
SevofluraneSevoflurane may increase the anticoagulant activities of Becaplermin.
SRT501SRT501 may increase the anticoagulant activities of Becaplermin.
StreptokinaseStreptokinase may increase the anticoagulant activities of Becaplermin.
SugammadexSugammadex may increase the anticoagulant activities of Becaplermin.
SulfasalazineSulfasalazine may increase the anticoagulant activities of Becaplermin.
SulindacSulindac may increase the anticoagulant activities of Becaplermin.
SulodexideBecaplermin may increase the anticoagulant activities of Sulodexide.
SuprofenSuprofen may increase the anticoagulant activities of Becaplermin.
Synthetic Conjugated Estrogens, ASynthetic Conjugated Estrogens, A may decrease the anticoagulant activities of Becaplermin.
Synthetic Conjugated Estrogens, BSynthetic Conjugated Estrogens, B may decrease the anticoagulant activities of Becaplermin.
TenecteplaseTenecteplase may increase the anticoagulant activities of Becaplermin.
TenoxicamTenoxicam may increase the anticoagulant activities of Becaplermin.
TepoxalinTepoxalin may increase the anticoagulant activities of Becaplermin.
TeriflunomideTeriflunomide may increase the anticoagulant activities of Becaplermin.
TesmilifeneTesmilifene may increase the anticoagulant activities of Becaplermin.
Tiaprofenic acidTiaprofenic acid may increase the anticoagulant activities of Becaplermin.
TiboloneTibolone may increase the anticoagulant activities of Becaplermin.
TicagrelorTicagrelor may increase the anticoagulant activities of Becaplermin.
TiclopidineTiclopidine may increase the anticoagulant activities of Becaplermin.
TinzaparinTinzaparin may increase the anticoagulant activities of Becaplermin.
TipranavirTipranavir may increase the anticoagulant activities of Becaplermin.
TirofibanTirofiban may increase the anticoagulant activities of Becaplermin.
Tolfenamic AcidTolfenamic Acid may increase the anticoagulant activities of Becaplermin.
TolmetinTolmetin may increase the anticoagulant activities of Becaplermin.
TositumomabThe risk or severity of adverse effects can be increased when Becaplermin is combined with Tositumomab.
TranilastTranilast may increase the anticoagulant activities of Becaplermin.
TrapidilTrapidil may increase the anticoagulant activities of Becaplermin.
TreprostinilTreprostinil may increase the anticoagulant activities of Becaplermin.
TriflusalTriflusal may increase the anticoagulant activities of Becaplermin.
Trisalicylate-cholineTrisalicylate-choline may increase the anticoagulant activities of Becaplermin.
UrokinaseUrokinase may increase the anticoagulant activities of Becaplermin.
ValdecoxibValdecoxib may increase the anticoagulant activities of Becaplermin.
Vitamin EVitamin E may increase the anticoagulant activities of Becaplermin.
VorapaxarThe risk or severity of adverse effects can be increased when Vorapaxar is combined with Becaplermin.
WarfarinBecaplermin may increase the anticoagulant activities of Warfarin.
XimelagatranBecaplermin may increase the anticoagulant activities of Ximelagatran.
ZaltoprofenZaltoprofen may increase the anticoagulant activities of Becaplermin.
ZeranolZeranol may decrease the anticoagulant activities of Becaplermin.
ZileutonZileuton may increase the anticoagulant activities of Becaplermin.
ZomepiracZomepirac may increase the anticoagulant activities of Becaplermin.
Food InteractionsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
General Function:
Vascular endothelial growth factor binding
Specific Function:
Tyrosine-protein kinase that acts as cell-surface receptor for homodimeric PDGFB and PDGFD and for heterodimers formed by PDGFA and PDGFB, and plays an essential role in the regulation of embryonic development, cell proliferation, survival, differentiation, chemotaxis and migration. Plays an essential role in blood vessel development by promoting proliferation, migration and recruitment of peri...
Gene Name:
PDGFRB
Uniprot ID:
P09619
Molecular Weight:
123966.895 Da
References
  1. Papanas N, Maltezos E: Becaplermin gel in the treatment of diabetic neuropathic foot ulcers. Clin Interv Aging. 2008;3(2):233-40. [PubMed:18686746 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Vascular endothelial growth factor-activated receptor activity
Specific Function:
Tyrosine-protein kinase that acts as a cell-surface receptor for PDGFA, PDGFB and PDGFC and plays an essential role in the regulation of embryonic development, cell proliferation, survival and chemotaxis. Depending on the context, promotes or inhibits cell proliferation and cell migration. Plays an important role in the differentiation of bone marrow-derived mesenchymal stem cells. Required for...
Gene Name:
PDGFRA
Uniprot ID:
P16234
Molecular Weight:
122668.46 Da
References
  1. Abdiu A, Walz TM, Nishikawa BK, Wingren S, Larsson SE, Wasteson A: Human malignant fibrous histiocytomas in vitro: growth characteristics and their association with expression of mRNA for platelet-derived growth factor, transforming growth factor-alpha and their receptors. Eur J Cancer. 1998 Dec;34(13):2094-100. [PubMed:10070317 ]
  2. Ebert M, Yokoyama M, Friess H, Kobrin MS, Buchler MW, Korc M: Induction of platelet-derived growth factor A and B chains and over-expression of their receptors in human pancreatic cancer. Int J Cancer. 1995 Sep 4;62(5):529-35. [PubMed:7665222 ]
  3. Miller-Kasprzak E, Niemir ZI, Czekalski S: [Structure and function of PDGF-R-alpha and its expression in normal kidney and kidney diseases]. Przegl Lek. 2002;59(10):826-31. [PubMed:12632922 ]
  4. Heidaran MA, Pierce JH, Lombardi D, Ruggiero M, Gutkind JS, Matsui T, Aaronson SA: Deletion or substitution within the alpha platelet-derived growth factor receptor kinase insert domain: effects on functional coupling with intracellular signaling pathways. Mol Cell Biol. 1991 Jan;11(1):134-42. [PubMed:1702511 ]
  5. Yu J, Liu XW, Kim HR: Platelet-derived growth factor (PDGF) receptor-alpha-activated c-Jun NH2-terminal kinase-1 is critical for PDGF-induced p21WAF1/CIP1 promoter activity independent of p53. J Biol Chem. 2003 Dec 5;278(49):49582-8. Epub 2003 Sep 23. [PubMed:14506245 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Tumor necrosis factor binding
Specific Function:
Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme remains active against low molecular weight...
Gene Name:
A2M
Uniprot ID:
P01023
Molecular Weight:
163289.945 Da
References
  1. Lizonova A, Bizik J, Grofova M, Vaheri A: Coexpression of tumor-associated alpha 2-macroglobulin and growth factors in human melanoma cell lines. J Cell Biochem. 1990 Aug;43(4):315-25. [PubMed:1697862 ]
  2. Bonner JC, Osornio-Vargas AR: Differential binding and regulation of platelet-derived growth factor A and B chain isoforms by alpha 2-macroglobulin. J Biol Chem. 1995 Jul 7;270(27):16236-42. [PubMed:7541796 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23