Drugbank Logo

Showing drug card for Cholestyramine (DB01432)

Legend: drug field target field enzyme field

Version 2.5
Creation Date 2007-07-24 18:41:58
Update Date 2009-06-23 18:08:00
Primary Accession Number DB01432
Secondary Accession Number Not Available
Name Cholestyramine
Drug Type
  • Approved
  • Small Molecule
Description Cholestyramine or colestyramine is a bile acid sequestrant. Bile acid sequestrants are polymeric compounds which serve as ion exchange resins. Cholestyramine resin is quite hydrophilic, but insoluble in water.
Synonyms
  1. Colestyramine
Brand Names
  1. Cholybar
  2. Locholest
  3. Locholest light
  4. Novo-Cholamine
  5. Novo-Cholamine Light
  6. PMS Cholestyramine
  7. Prevalite
  8. Questran
  9. Questran Light
Brand Mixtures Not Available
Chemical IUPAC Name Not Available
Chemical Formula Not Available
Chemical Structure Structure
CAS Registry Number 11041-12-6
InChI Identifier Not Available
InChI Key Not Available
KEGG Drug Not Available
KEGG Compound Not Available
PubChem Compound Not Available
PubChem Substance Not Available
ChEBI ID Not Available
PharmGKB ID PA448974 Link Image
HET ID Not Available
GenBank ID Not Available
Drug ID Number [DIN] 00890960 Link Image
RxList Link http://www.rxlist.com/cgi/generic/cholestyramine.htm Link Image
PDRhealth Link Not Available
Wikipedia Link http://en.wikipedia.org/wiki/Cholestyramine Link Image
FDA Label Not Available
Material Safety Data Sheet (MSDS)
Synthesis Reference Not Available
Average Molecular Weight Not Available
Monoisotopic Molecular Weight Not Available
State Solid
Melting Point Not Available
Experimental Water Solubility Insoluble Source: PhysProp
Predicted Water Solubility Not Available Calculated using ALOGPS
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP Not Available Calculated using ALOGPS
Experimental LogS Not Available
Predicted LogS Not Available Calculated using ALOGPS
Experimental Caco2 Permeability Not Available
pKa/Isoelectric Point Not Available
Mass Spectrum Not Available
MOL File Not Available
SDF File Not Available
PDB File Not Available
Experimental PDB ID Not Available
Isomeric SMILES Not Available
Canonical SMILES Not Available
Drug Category
  • Anticholesteremic Agents
  • Antihyperlipidemics
  • Cholesterol Absorption Inhibitors
ATC Codes
AHFS Codes
  • 24:06.04
Indication Indicated as adjunctive therapy to diet for the reduction of elevated serum cholesterol in patients with primary hypercholesterolemia (elevated low density lipoprotein [LDL] cholesterol) who do not respond adequately to diet. Also for the relief of pruritus associated with partial biliary obstruction.
Pharmacology Cholesterol is probably the sole precursor of bile acids. During normal digestion, bile acids are secreted into the intestines. A major portion of the bile acids is absorbed from the intestinal tract and returned to the liver via the enterohepatic circulation. Only very small amounts of bile acids are found in normal serum. Cholestyramine resin adsorbs and combines with the bile acids in the intestine to form an insoluble complex which is excreted in the feces. This results in a partial removal of bile acids from the enterohepatic circulation by preventing their absorption.
Mechanism of Action Cholestyramine binds bile in the gastrointestinal tract to prevent its reabsorption. The resin is a strong anion exchange resin, which means that it can exchange its chloride anions with anionic bile acids in the gastrointestinal tract and bind them strongly in the resin matrix. The functional group of the anion exchange resin is a quaternary ammonium group attached to an inert styrene-divinylbenzene copolymer.
Absorption Not absorbed from the gastrointestinal tract following oral administration.
Toxicity Overdose may result in blockage of intestine or stomach.
Protein Binding Not Available
Biotransformation Bile acids
Half Life 6 minutes
Dosage Forms
Form Route
Powder Oral
Powder, for solution Oral
Powder, for suspension Oral
Patient Information Show Link Image
Contraindications Show Link Image
Interactions Show Link Image
Drug Interactions
Drug Interaction
Acenocoumarol The gastro-intestinal binding agent decreases the anticoagulant effect
Acenocoumarol The gastro-intestinal binding agent decreases the anticoagulant effect
Anisindione The gastro-intestinal binding agent decreases the anticoagulant effect
Dicumarol The gastro-intestinal binding agent decreases the anticoagulant effect
Digoxin The resin decreases the effect of digoxin
Ezetimibe Decreases the levels of ezetimibe
Fluvastatin Increased/decreased effect according to spacing
Hydrocortisone Decreases the effect of hydrocortisone
Levothyroxine The resin decreases the absorption of thyroid hormones
Liothyronine The resin decreases the absorption of thyroid hormones
Liotrix The resin decreases the absorption of thyroid hormones
Methotrexate Decreased levels of methotrexate
Raloxifene The resin decreases the effect of raloxifene
Spironolactone Increased risk of acidosis and hyperkaliemia
Thyroglobulin The resin decreases the absorption of thyroid hormones
Troglitazone Decreases the effect of troglitazone
Ursodeoxycholic acid The resin decreases the effect of ursodiol
Warfarin The gastro-intestinal binding agent decreases the anticoagulant effect
Food Interactions
  • Take with food, do not mix with soft drinks.
Pathways Not Available
General References
  1. Wikipedia Link Image
  2. RxList Link Image
Organisms Affected
  • Humans and other mammals
Phase 1 Metabolizing Enzymes
  1. Liver carboxylesterase
Phase 1 Metabolizing Enzyme 1 [top]
Enzyme 1 Name Liver carboxylesterase
Enzyme 1 Gene Name CES1
Enzyme 1 SwissProt ID P23141 Link Image
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 Protein Sequence >sp|P23141|EST1_HUMAN Liver carboxylesterase 1 precursor (EC 3.1.1.1)
MWLRAFILATLSASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPL
GPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCLYLN
IYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFST
GDEHSRGNWGHLDQVAALRWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLF
HRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLK
MKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVPYMVGINKQEFGWLIP
MQLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTVKKKDLFLDL
IADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPF
LKEGASEEEIRLSKMVMKFWANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLK
DKEVAFWTNLFAKKAVEKPPQTEHIEL

This project is supported by Genome Alberta & Genome Canada, a not-for-profit organization that is leading Canada's national genomics strategy with $600 million in funding from the federal government. This project is also supported in part by GenomeQuest, Inc., an enterprise genomic information company serving the life science community.