You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameSiltuximab
Accession NumberDB09036
TypeBiotech
GroupsApproved
Description

Siltuximab is a chimeric (human-mouse) monoclonal immunoglobulin G1-kappa antibody produced in a Chinese hamster ovary (CHO) cell line by recombinant DNA technology. Siltuximab prevents the binding of IL-6 to soluble and membrane-bound IL-6 receptors by forming high affinity complexes with human interleukin-6 (IL-6). Its use is indicated for the treatment of adult patients with multicentric Castleman’s disease (MCD) who are human immunodeficiency virus (HIV) negative and human herpesvirus-8 (HHV-8) negative. MCD is a rare blood disorder caused by dysregulated IL-6 production, proliferation of lymphocytes, and subsequent enlargement of the lymph nodes. It is administered as a 1 hour intravenous infusion every 3 weeks.

Protein structureDb09036
Related Articles
Protein chemical formulaC6450H9932N1688O2016S50
Protein average weight145000.0 Da
Sequences
>Heavy Chain Sequence
EVQLVESGGKLLKPGGSLKLSCAASGFTFSSFAMSWFRQSPEKRLEWVAEISSGGSYTYY
PDTVTGRFTISRDNAKNTLYLEMSSLRSEDTAMYYCARGLWGYYALDYWGQGTSVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSLSPGK
>Light Chain Sequence
QIVLIQSPAIMSASPGEKVTMTCSASSSVSYMYWYQQKPGSSPRLLIYDTSNLASGVPVR
FSGSGSGTSYSLTISRMEAEDAATYYCQQWSGYPYTFGGGTKLEIKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
SynonymsNot Available
External Identifiers
  • CLLB8
  • CNTO 328
  • CNTO-328
  • CNTO328
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Sylvantinjection, powder, lyophilized, for solution100 mg/1intravenousJanssen Biotech, Inc.2014-04-23Not applicableUs
Sylvantpowder for solution100 mgintravenousJanssen Inc2015-03-03Not applicableCanada
Sylvantpowder for solution400 mgintravenousJanssen Inc2015-03-03Not applicableCanada
Sylvantinjection, powder, lyophilized, for solution400 mg/1intravenousJanssen Biotech, Inc.2014-04-01Not applicableUs
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNIIT4H8FMA7IM
CAS number541502-14-1
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationSiltuximab is indicated for the treatment of patients with multicentric Castleman's disease (MCD) who are human immunodeficiency virus (HIV) negative and human herpesvirus-8 (HHV-8) negative. Siltuximab did not bind to virally produced IL-6 in a nonclinical study and was therefore not studied in patients with MCD who are HIV or HHV-8 positive.
PharmacodynamicsSiltuximab-neutralized antibody-IL-6 complexes interfere with current immunological-based IL-6 quantification methods, therefore measurement of serum or plasma IL-6 concentrations should not be used as a pharmacodynamic marker during treatment. As well, cytochrome P450 enzymes in the liver are down regulated by infection and inflammation stimuli, which includes cytokines such as IL-6. By preventing IL-6 signalling through treatment with siltuximab, CYP450 activity may be increased leading to faster metabolism of drugs that are CYP450 substrates.
Mechanism of actionSiltuximab complexes with human IL-6 and prevents binding to soluble and membrane-bound IL-6 receptors, thereby inhibiting the proliferation of lymphocytes.
Related Articles
AbsorptionNot Available
Volume of distribution

Based on population pharmacokinetic analysis, the central volume of distribution in a male subject with body weight of 70 kg is 4.5 L.

Protein bindingNot Available
Metabolism

As siltuximab is an antibody, the expected consequence of metabolism is proteolytic degradation to small peptides and individual amino acids, and receptor-mediated clearance.

Route of eliminationNot Available
Half lifeThe mean terminal half life after the first intravenous infusion of 11 mg/kg is 20.6 days.
Clearance

Body weight was identified as the only statistically significant covariate of siltuximab clearance, therefore body weight based dosing is appropriate. Based on population pharmacokinetic analysis, the clearance of situximab in patients is 0.23 L/day.

ToxicityThe most common side effects that occurred during siltuximab treatment were pruritis, increased weight, rash, hyperuricemia, and upper respiratory tract infection. Siltuximab should not be administered to patients with severe infections as it may mask signs and symptoms of acute inflammation including suppression of fever and acute phase reactants such as C-reactive protein (CRP). Gastrointestinal perforation has been reported in clinical trials, therefore use with caution in patients who may be at increased risk for GI perforation.
Affected organismsNot Available
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
ManufacturersNot Available
PackagersNot Available
Dosage forms
FormRouteStrength
Injection, powder, lyophilized, for solutionintravenous100 mg/1
Injection, powder, lyophilized, for solutionintravenous400 mg/1
Powder for solutionintravenous100 mg
Powder for solutionintravenous400 mg
PricesNot Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US7612182 No2007-08-012027-08-01Us
Properties
StateSolid
Experimental PropertiesNot Available
References
Synthesis ReferenceNot Available
General References
  1. Puchalski T, Prabhakar U, Jiao Q, Berns B, Davis HM: Pharmacokinetic and pharmacodynamic modeling of an anti-interleukin-6 chimeric monoclonal antibody (siltuximab) in patients with metastatic renal cell carcinoma. Clin Cancer Res. 2010 Mar 1;16(5):1652-61. doi: 10.1158/1078-0432.CCR-09-2581. Epub 2010 Feb 23. [PubMed:20179212 ]
  2. Deisseroth A, Ko CW, Nie L, Zirkelbach JF, Zhao L, Bullock J, Mehrotra N, Del Valle P, Saber H, Sheth C, Gehrke B, Justice R, Farrell A, Pazdur R: FDA approval: siltuximab for the treatment of patients with multicentric Castleman disease. Clin Cancer Res. 2015 Mar 1;21(5):950-4. doi: 10.1158/1078-0432.CCR-14-1678. Epub 2015 Jan 19. [PubMed:25601959 ]
  3. Liu YC, Stone K, van Rhee F: Siltuximab for multicentric Castleman disease. Expert Rev Hematol. 2014 Oct;7(5):545-57. doi: 10.1586/17474086.2014.946402. Epub 2014 Aug 9. [PubMed:25110138 ]
External Links
ATC CodesL04AC11
AHFS Codes
  • 10:00
PDB EntriesNot Available
FDA labelDownload (326 KB)
MSDSNot Available
Interactions
Drug Interactions
Drug
AbirateroneThe serum concentration of Abiraterone can be decreased when it is combined with Siltuximab.
AlfuzosinThe serum concentration of Alfuzosin can be decreased when it is combined with Siltuximab.
AlprazolamThe serum concentration of Alprazolam can be decreased when it is combined with Siltuximab.
AminophyllineThe serum concentration of Aminophylline can be decreased when it is combined with Siltuximab.
AmiodaroneThe serum concentration of Amiodarone can be decreased when it is combined with Siltuximab.
AmlodipineThe serum concentration of Amlodipine can be decreased when it is combined with Siltuximab.
ApixabanThe serum concentration of Apixaban can be decreased when it is combined with Siltuximab.
ApremilastThe serum concentration of Apremilast can be decreased when it is combined with Siltuximab.
AprepitantThe serum concentration of Aprepitant can be decreased when it is combined with Siltuximab.
AripiprazoleThe serum concentration of Aripiprazole can be decreased when it is combined with Siltuximab.
ArmodafinilThe serum concentration of Armodafinil can be decreased when it is combined with Siltuximab.
AtazanavirThe serum concentration of Atazanavir can be decreased when it is combined with Siltuximab.
AtorvastatinThe serum concentration of Atorvastatin can be decreased when it is combined with Siltuximab.
AvanafilThe serum concentration of Avanafil can be decreased when it is combined with Siltuximab.
AxitinibThe serum concentration of Axitinib can be decreased when it is combined with Siltuximab.
BedaquilineThe serum concentration of Bedaquiline can be decreased when it is combined with Siltuximab.
BelimumabThe risk or severity of adverse effects can be increased when Siltuximab is combined with Belimumab.
BenzphetamineThe serum concentration of Benzphetamine can be decreased when it is combined with Siltuximab.
BisoprololThe serum concentration of Bisoprolol can be decreased when it is combined with Siltuximab.
BoceprevirThe serum concentration of Boceprevir can be decreased when it is combined with Siltuximab.
BortezomibThe serum concentration of Bortezomib can be decreased when it is combined with Siltuximab.
BosutinibThe serum concentration of Bosutinib can be decreased when it is combined with Siltuximab.
BrexpiprazoleThe serum concentration of Brexpiprazole can be decreased when it is combined with Siltuximab.
BuprenorphineThe serum concentration of Buprenorphine can be decreased when it is combined with Siltuximab.
BuspironeThe serum concentration of Buspirone can be decreased when it is combined with Siltuximab.
CabazitaxelThe serum concentration of Cabazitaxel can be decreased when it is combined with Siltuximab.
CabozantinibThe serum concentration of Cabozantinib can be decreased when it is combined with Siltuximab.
CalcitriolThe serum concentration of Calcitriol can be decreased when it is combined with Siltuximab.
CarbamazepineThe serum concentration of Carbamazepine can be decreased when it is combined with Siltuximab.
CeritinibThe serum concentration of Ceritinib can be decreased when it is combined with Siltuximab.
ChlordiazepoxideThe serum concentration of Chlordiazepoxide can be decreased when it is combined with Siltuximab.
ChloroquineThe serum concentration of Chloroquine can be decreased when it is combined with Siltuximab.
CilostazolThe serum concentration of Cilostazol can be decreased when it is combined with Siltuximab.
CitalopramThe serum concentration of Citalopram can be decreased when it is combined with Siltuximab.
ClarithromycinThe serum concentration of Clarithromycin can be decreased when it is combined with Siltuximab.
ClonazepamThe serum concentration of Clonazepam can be decreased when it is combined with Siltuximab.
ClorazepateThe serum concentration of Clorazepate can be decreased when it is combined with Siltuximab.
CobicistatThe serum concentration of Cobicistat can be decreased when it is combined with Siltuximab.
CobimetinibThe serum concentration of Cobimetinib can be decreased when it is combined with Siltuximab.
ConivaptanThe serum concentration of Conivaptan can be decreased when it is combined with Siltuximab.
CrizotinibThe serum concentration of Crizotinib can be decreased when it is combined with Siltuximab.
CyclosporineThe serum concentration of Cyclosporine can be decreased when it is combined with Siltuximab.
Cyproterone acetateThe serum concentration of Cyproterone acetate can be decreased when it is combined with Siltuximab.
DaclatasvirThe serum concentration of Daclatasvir can be decreased when it is combined with Siltuximab.
DantroleneThe serum concentration of Dantrolene can be decreased when it is combined with Siltuximab.
DapsoneThe serum concentration of Dapsone can be decreased when it is combined with Siltuximab.
DarifenacinThe serum concentration of Darifenacin can be decreased when it is combined with Siltuximab.
DarunavirThe serum concentration of Darunavir can be decreased when it is combined with Siltuximab.
DasatinibThe serum concentration of Dasatinib can be decreased when it is combined with Siltuximab.
DelavirdineThe serum concentration of Delavirdine can be decreased when it is combined with Siltuximab.
DenosumabThe risk or severity of adverse effects can be increased when Denosumab is combined with Siltuximab.
DexamethasoneThe serum concentration of Dexamethasone can be decreased when it is combined with Siltuximab.
DiazepamThe serum concentration of Diazepam can be decreased when it is combined with Siltuximab.
DienogestThe serum concentration of Dienogest can be decreased when it is combined with Siltuximab.
DiltiazemThe serum concentration of Diltiazem can be decreased when it is combined with Siltuximab.
DisopyramideThe serum concentration of Disopyramide can be decreased when it is combined with Siltuximab.
DocetaxelThe serum concentration of Docetaxel can be decreased when it is combined with Siltuximab.
DoxazosinThe serum concentration of Doxazosin can be decreased when it is combined with Siltuximab.
DoxorubicinThe serum concentration of Doxorubicin can be decreased when it is combined with Siltuximab.
DronedaroneThe serum concentration of Dronedarone can be decreased when it is combined with Siltuximab.
EfavirenzThe serum concentration of Efavirenz can be decreased when it is combined with Siltuximab.
EliglustatThe serum concentration of Eliglustat can be decreased when it is combined with Siltuximab.
ElvitegravirThe serum concentration of Elvitegravir can be decreased when it is combined with Siltuximab.
EnzalutamideThe serum concentration of Enzalutamide can be decreased when it is combined with Siltuximab.
EplerenoneThe serum concentration of Eplerenone can be decreased when it is combined with Siltuximab.
ErlotinibThe serum concentration of Erlotinib can be decreased when it is combined with Siltuximab.
ErythromycinThe serum concentration of Erythromycin can be decreased when it is combined with Siltuximab.
EscitalopramThe serum concentration of Escitalopram can be decreased when it is combined with Siltuximab.
EstradiolThe serum concentration of Estradiol can be decreased when it is combined with Siltuximab.
Estrone sulfateThe serum concentration of Estropipate can be decreased when it is combined with Siltuximab.
EszopicloneThe serum concentration of Eszopiclone can be decreased when it is combined with Siltuximab.
EthosuximideThe serum concentration of Ethosuximide can be decreased when it is combined with Siltuximab.
EtoposideThe serum concentration of Etoposide can be decreased when it is combined with Siltuximab.
EtravirineThe serum concentration of Etravirine can be decreased when it is combined with Siltuximab.
EverolimusThe serum concentration of Everolimus can be decreased when it is combined with Siltuximab.
ExemestaneThe serum concentration of Exemestane can be decreased when it is combined with Siltuximab.
FelbamateThe serum concentration of Felbamate can be decreased when it is combined with Siltuximab.
FelodipineThe serum concentration of Felodipine can be decreased when it is combined with Siltuximab.
FesoterodineThe serum concentration of Fesoterodine can be decreased when it is combined with Siltuximab.
FlibanserinThe serum concentration of Flibanserin can be decreased when it is combined with Siltuximab.
FlunisolideThe serum concentration of Flunisolide can be decreased when it is combined with Siltuximab.
FlurazepamThe serum concentration of Flurazepam can be decreased when it is combined with Siltuximab.
FlutamideThe serum concentration of Flutamide can be decreased when it is combined with Siltuximab.
FosamprenavirThe serum concentration of Fosamprenavir can be decreased when it is combined with Siltuximab.
FosaprepitantThe serum concentration of Fosaprepitant can be decreased when it is combined with Siltuximab.
GefitinibThe serum concentration of Gefitinib can be decreased when it is combined with Siltuximab.
GuanfacineThe serum concentration of Guanfacine can be decreased when it is combined with Siltuximab.
HaloperidolThe serum concentration of Haloperidol can be decreased when it is combined with Siltuximab.
HydrocodoneThe serum concentration of Hydrocodone can be decreased when it is combined with Siltuximab.
Hydroxyprogesterone caproateThe serum concentration of Hydroxyprogesterone caproate can be decreased when it is combined with Siltuximab.
IbrutinibThe serum concentration of Ibrutinib can be decreased when it is combined with Siltuximab.
IdelalisibThe serum concentration of Idelalisib can be decreased when it is combined with Siltuximab.
ImatinibThe serum concentration of Imatinib can be decreased when it is combined with Siltuximab.
IndinavirThe serum concentration of Indinavir can be decreased when it is combined with Siltuximab.
IrinotecanThe serum concentration of Irinotecan can be decreased when it is combined with Siltuximab.
IsavuconazoniumThe serum concentration of Isavuconazonium can be decreased when it is combined with Siltuximab.
IsosorbideThe serum concentration of Isosorbide can be decreased when it is combined with Siltuximab.
Isosorbide DinitrateThe serum concentration of Isosorbide Dinitrate can be decreased when it is combined with Siltuximab.
Isosorbide MononitrateThe serum concentration of Isosorbide Mononitrate can be decreased when it is combined with Siltuximab.
IsradipineThe serum concentration of Isradipine can be decreased when it is combined with Siltuximab.
ItraconazoleThe serum concentration of Itraconazole can be decreased when it is combined with Siltuximab.
IvabradineThe serum concentration of Ivabradine can be decreased when it is combined with Siltuximab.
IvacaftorThe serum concentration of Ivacaftor can be decreased when it is combined with Siltuximab.
IxabepiloneThe serum concentration of Ixabepilone can be decreased when it is combined with Siltuximab.
IxazomibThe serum concentration of Ixazomib can be decreased when it is combined with Siltuximab.
KetoconazoleThe serum concentration of Ketoconazole can be decreased when it is combined with Siltuximab.
LansoprazoleThe serum concentration of Lansoprazole can be decreased when it is combined with Siltuximab.
LapatinibThe serum concentration of Lapatinib can be decreased when it is combined with Siltuximab.
LeflunomideThe risk or severity of adverse effects can be increased when Siltuximab is combined with Leflunomide.
LevonorgestrelThe serum concentration of Levonorgestrel can be decreased when it is combined with Siltuximab.
LidocaineThe serum concentration of Lidocaine can be decreased when it is combined with Siltuximab.
LomitapideThe serum concentration of Lomitapide can be decreased when it is combined with Siltuximab.
LosartanThe serum concentration of Losartan can be decreased when it is combined with Siltuximab.
LovastatinThe serum concentration of Lovastatin can be decreased when it is combined with Siltuximab.
LurasidoneThe serum concentration of Lurasidone can be decreased when it is combined with Siltuximab.
MacitentanThe serum concentration of MACITENTAN can be decreased when it is combined with Siltuximab.
MaravirocThe serum concentration of Maraviroc can be decreased when it is combined with Siltuximab.
Medroxyprogesterone acetateThe serum concentration of Medroxyprogesterone Acetate can be decreased when it is combined with Siltuximab.
MefloquineThe serum concentration of Mefloquine can be decreased when it is combined with Siltuximab.
MethadoneThe serum concentration of Methadone can be decreased when it is combined with Siltuximab.
MidazolamThe serum concentration of Midazolam can be decreased when it is combined with Siltuximab.
MifepristoneThe serum concentration of Mifepristone can be decreased when it is combined with Siltuximab.
MirtazapineThe serum concentration of Mirtazapine can be decreased when it is combined with Siltuximab.
ModafinilThe serum concentration of Modafinil can be decreased when it is combined with Siltuximab.
NaloxegolThe serum concentration of Naloxegol can be decreased when it is combined with Siltuximab.
NatalizumabThe risk or severity of adverse effects can be increased when Siltuximab is combined with Natalizumab.
NateglinideThe serum concentration of Nateglinide can be decreased when it is combined with Siltuximab.
NefazodoneThe serum concentration of Nefazodone can be decreased when it is combined with Siltuximab.
NelfinavirThe serum concentration of Nelfinavir can be decreased when it is combined with Siltuximab.
NevirapineThe serum concentration of Nevirapine can be decreased when it is combined with Siltuximab.
NicardipineThe serum concentration of Nicardipine can be decreased when it is combined with Siltuximab.
NifedipineThe serum concentration of Nifedipine can be decreased when it is combined with Siltuximab.
NilotinibThe serum concentration of Nilotinib can be decreased when it is combined with Siltuximab.
NimodipineThe serum concentration of Nimodipine can be decreased when it is combined with Siltuximab.
NisoldipineThe serum concentration of Nisoldipine can be decreased when it is combined with Siltuximab.
NorethisteroneThe serum concentration of Norethindrone can be decreased when it is combined with Siltuximab.
OlaparibThe serum concentration of Olaparib can be decreased when it is combined with Siltuximab.
OndansetronThe serum concentration of Ondansetron can be decreased when it is combined with Siltuximab.
OspemifeneThe serum concentration of Ospemifene can be decreased when it is combined with Siltuximab.
OxycodoneThe serum concentration of Oxycodone can be decreased when it is combined with Siltuximab.
PaclitaxelThe serum concentration of Paclitaxel can be decreased when it is combined with Siltuximab.
PalbociclibThe serum concentration of Palbociclib can be decreased when it is combined with Siltuximab.
PanobinostatThe serum concentration of Panobinostat can be decreased when it is combined with Siltuximab.
PazopanibThe serum concentration of Pazopanib can be decreased when it is combined with Siltuximab.
PerampanelThe serum concentration of Perampanel can be decreased when it is combined with Siltuximab.
PimecrolimusThe risk or severity of adverse effects can be increased when Pimecrolimus is combined with Siltuximab.
PimozideThe serum concentration of Pimozide can be decreased when it is combined with Siltuximab.
PipotiazineThe serum concentration of Pipotiazine can be decreased when it is combined with Siltuximab.
PraziquantelThe serum concentration of Praziquantel can be decreased when it is combined with Siltuximab.
PrimaquineThe serum concentration of Primaquine can be decreased when it is combined with Siltuximab.
ProgesteroneThe serum concentration of Progesterone can be decreased when it is combined with Siltuximab.
QuetiapineThe serum concentration of Quetiapine can be decreased when it is combined with Siltuximab.
QuinidineThe serum concentration of Quinidine can be decreased when it is combined with Siltuximab.
QuinineThe serum concentration of Quinine can be decreased when it is combined with Siltuximab.
RabeprazoleThe serum concentration of Rabeprazole can be decreased when it is combined with Siltuximab.
RanolazineThe serum concentration of Ranolazine can be decreased when it is combined with Siltuximab.
RegorafenibThe serum concentration of Regorafenib can be decreased when it is combined with Siltuximab.
RepaglinideThe serum concentration of Repaglinide can be decreased when it is combined with Siltuximab.
RifabutinThe serum concentration of Rifabutin can be decreased when it is combined with Siltuximab.
RilpivirineThe serum concentration of Rilpivirine can be decreased when it is combined with Siltuximab.
RiociguatThe serum concentration of Riociguat can be decreased when it is combined with Siltuximab.
RitonavirThe serum concentration of Ritonavir can be decreased when it is combined with Siltuximab.
RivaroxabanThe serum concentration of Rivaroxaban can be decreased when it is combined with Siltuximab.
RoflumilastRoflumilast may increase the immunosuppressive activities of Siltuximab.
RolapitantThe serum concentration of Rolapitant can be decreased when it is combined with Siltuximab.
RuxolitinibThe serum concentration of Ruxolitinib can be decreased when it is combined with Siltuximab.
SaquinavirThe serum concentration of Saquinavir can be decreased when it is combined with Siltuximab.
SildenafilThe serum concentration of Sildenafil can be decreased when it is combined with Siltuximab.
SilodosinThe serum concentration of Silodosin can be decreased when it is combined with Siltuximab.
SimeprevirThe serum concentration of Simeprevir can be decreased when it is combined with Siltuximab.
SimvastatinThe serum concentration of Simvastatin can be decreased when it is combined with Siltuximab.
Sipuleucel-TThe therapeutic efficacy of Sipuleucel-T can be decreased when used in combination with Siltuximab.
SirolimusThe serum concentration of Sirolimus can be decreased when it is combined with Siltuximab.
SolifenacinThe serum concentration of Solifenacin can be decreased when it is combined with Siltuximab.
SonidegibThe serum concentration of Sonidegib can be decreased when it is combined with Siltuximab.
SpiramycinThe serum concentration of Spiramycin can be decreased when it is combined with Siltuximab.
StiripentolThe serum concentration of Stiripentol can be decreased when it is combined with Siltuximab.
SunitinibThe serum concentration of Sunitinib can be decreased when it is combined with Siltuximab.
SuvorexantThe serum concentration of Suvorexant can be decreased when it is combined with Siltuximab.
TacrolimusThe serum concentration of Tacrolimus can be decreased when it is combined with Siltuximab.
TamoxifenThe serum concentration of Tamoxifen can be decreased when it is combined with Siltuximab.
TamsulosinThe serum concentration of Tamsulosin can be decreased when it is combined with Siltuximab.
TasimelteonThe serum concentration of Tasimelteon can be decreased when it is combined with Siltuximab.
TelaprevirThe serum concentration of Telaprevir can be decreased when it is combined with Siltuximab.
TelithromycinThe serum concentration of Telithromycin can be decreased when it is combined with Siltuximab.
TemsirolimusThe serum concentration of Temsirolimus can be decreased when it is combined with Siltuximab.
TeniposideThe serum concentration of Teniposide can be decreased when it is combined with Siltuximab.
TetracyclineThe serum concentration of Tetracycline can be decreased when it is combined with Siltuximab.
TheophyllineThe serum concentration of Theophylline can be decreased when it is combined with Siltuximab.
TiagabineThe serum concentration of Tiagabine can be decreased when it is combined with Siltuximab.
TicagrelorThe serum concentration of Ticagrelor can be decreased when it is combined with Siltuximab.
TiclopidineThe serum concentration of Ticlopidine can be decreased when it is combined with Siltuximab.
TipranavirThe serum concentration of Tipranavir can be decreased when it is combined with Siltuximab.
TofacitinibSiltuximab may increase the immunosuppressive activities of Tofacitinib.
TolterodineThe serum concentration of Tolterodine can be decreased when it is combined with Siltuximab.
TolvaptanThe serum concentration of Tolvaptan can be decreased when it is combined with Siltuximab.
ToremifeneThe serum concentration of Toremifene can be decreased when it is combined with Siltuximab.
TrabectedinThe serum concentration of Trabectedin can be decreased when it is combined with Siltuximab.
TramadolThe serum concentration of Tramadol can be decreased when it is combined with Siltuximab.
TrastuzumabTrastuzumab may increase the neutropenic activities of Siltuximab.
TrazodoneThe serum concentration of Trazodone can be decreased when it is combined with Siltuximab.
TriazolamThe serum concentration of Triazolam can be decreased when it is combined with Siltuximab.
TrimethoprimThe serum concentration of Trimethoprim can be decreased when it is combined with Siltuximab.
TrimipramineThe serum concentration of Trimipramine can be decreased when it is combined with Siltuximab.
UlipristalThe serum concentration of Ulipristal can be decreased when it is combined with Siltuximab.
VandetanibThe serum concentration of Vandetanib can be decreased when it is combined with Siltuximab.
VemurafenibThe serum concentration of Vemurafenib can be decreased when it is combined with Siltuximab.
VenlafaxineThe serum concentration of Venlafaxine can be decreased when it is combined with Siltuximab.
VerapamilThe serum concentration of Verapamil can be decreased when it is combined with Siltuximab.
VilazodoneThe serum concentration of Vilazodone can be decreased when it is combined with Siltuximab.
VinblastineThe serum concentration of Vinblastine can be decreased when it is combined with Siltuximab.
VincristineThe serum concentration of Vincristine can be decreased when it is combined with Siltuximab.
VinorelbineThe serum concentration of Vinorelbine can be decreased when it is combined with Siltuximab.
VortioxetineThe serum concentration of Vortioxetine can be decreased when it is combined with Siltuximab.
ZolpidemThe serum concentration of Zolpidem can be decreased when it is combined with Siltuximab.
ZonisamideThe serum concentration of Zonisamide can be decreased when it is combined with Siltuximab.
ZopicloneThe serum concentration of Zopiclone can be decreased when it is combined with Siltuximab.
Food InteractionsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
antagonistantibody
General Function:
Interleukin-6 receptor binding
Specific Function:
Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T(H)17 cells. Also acts as ...
Gene Name:
IL6
Uniprot ID:
P05231
Molecular Weight:
23717.965 Da
References
  1. van Zaanen HC, Koopmans RP, Aarden LA, Rensink HJ, Stouthard JM, Warnaar SO, Lokhorst HM, van Oers MH: Endogenous interleukin 6 production in multiple myeloma patients treated with chimeric monoclonal anti-IL6 antibodies indicates the existence of a positive feed-back loop. J Clin Invest. 1996 Sep 15;98(6):1441-8. [PubMed:8823310 ]
Comments
comments powered by Disqus
Drug created on March 16, 2015 13:35 / Updated on March 14, 2016 10:05