You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameSiltuximab
Accession NumberDB09036
TypeBiotech
GroupsApproved
DescriptionSiltuximab is a chimeric (human-mouse) monoclonal immunoglobulin G1-kappa antibody produced in a Chinese hamster ovary (CHO) cell line by recombinant DNA technology. Siltuximab prevents the binding of IL-6 to soluble and membrane-bound IL-6 receptors by forming high affinity complexes with human interleukin-6 (IL-6). Its use is indicated for the treatment of adult patients with multicentric Castleman's disease (MCD) who are human immunodeficiency virus (HIV) negative and human herpesvirus-8 (HHV-8) negative. MCD is a rare blood disorder caused by dysregulated IL-6 production, proliferation of lymphocytes, and subsequent enlargement of the lymph nodes. It is administered as a 1 hour intravenous infusion every 3 weeks.
Protein structureDb09036
Related Articles
Protein chemical formulaC6450H9932N1688O2016S50
Protein average weight145000.0 Da
Sequences
>Heavy Chain Sequence
EVQLVESGGKLLKPGGSLKLSCAASGFTFSSFAMSWFRQSPEKRLEWVAEISSGGSYTYY
PDTVTGRFTISRDNAKNTLYLEMSSLRSEDTAMYYCARGLWGYYALDYWGQGTSVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSLSPGK
>Light Chain Sequence
QIVLIQSPAIMSASPGEKVTMTCSASSSVSYMYWYQQKPGSSPRLLIYDTSNLASGVPVR
FSGSGSGTSYSLTISRMEAEDAATYYCQQWSGYPYTFGGGTKLEIKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
SynonymsNot Available
External Identifiers
  • CLLB8
  • CNTO 328
  • CNTO-328
  • CNTO328
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Sylvantinjection, powder, lyophilized, for solution100 mg/1intravenousJanssen Biotech, Inc.2014-04-23Not applicableUs
Sylvantinjection, powder, lyophilized, for solution400 mg/1intravenousJanssen Biotech, Inc.2014-04-01Not applicableUs
Sylvantpowder for solution400 mgintravenousJanssen Inc2015-03-03Not applicableCanada
Sylvantpowder for solution100 mgintravenousJanssen Inc2015-03-03Not applicableCanada
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNIIT4H8FMA7IM
CAS number541502-14-1
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationSiltuximab is indicated for the treatment of patients with multicentric Castleman's disease (MCD) who are human immunodeficiency virus (HIV) negative and human herpesvirus-8 (HHV-8) negative. Siltuximab did not bind to virally produced IL-6 in a nonclinical study and was therefore not studied in patients with MCD who are HIV or HHV-8 positive.
PharmacodynamicsSiltuximab-neutralized antibody-IL-6 complexes interfere with current immunological-based IL-6 quantification methods, therefore measurement of serum or plasma IL-6 concentrations should not be used as a pharmacodynamic marker during treatment. As well, cytochrome P450 enzymes in the liver are down regulated by infection and inflammation stimuli, which includes cytokines such as IL-6. By preventing IL-6 signalling through treatment with siltuximab, CYP450 activity may be increased leading to faster metabolism of drugs that are CYP450 substrates.
Mechanism of actionSiltuximab complexes with human IL-6 and prevents binding to soluble and membrane-bound IL-6 receptors, thereby inhibiting the proliferation of lymphocytes.
Related Articles
AbsorptionNot Available
Volume of distribution

Based on population pharmacokinetic analysis, the central volume of distribution in a male subject with body weight of 70 kg is 4.5 L.

Protein bindingNot Available
Metabolism

As siltuximab is an antibody, the expected consequence of metabolism is proteolytic degradation to small peptides and individual amino acids, and receptor-mediated clearance.

Route of eliminationNot Available
Half lifeThe mean terminal half life after the first intravenous infusion of 11 mg/kg is 20.6 days.
Clearance

Body weight was identified as the only statistically significant covariate of siltuximab clearance, therefore body weight based dosing is appropriate. Based on population pharmacokinetic analysis, the clearance of situximab in patients is 0.23 L/day.

ToxicityThe most common side effects that occurred during siltuximab treatment were pruritis, increased weight, rash, hyperuricemia, and upper respiratory tract infection. Siltuximab should not be administered to patients with severe infections as it may mask signs and symptoms of acute inflammation including suppression of fever and acute phase reactants such as C-reactive protein (CRP). Gastrointestinal perforation has been reported in clinical trials, therefore use with caution in patients who may be at increased risk for GI perforation.
Affected organismsNot Available
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
ManufacturersNot Available
PackagersNot Available
Dosage forms
FormRouteStrength
Injection, powder, lyophilized, for solutionintravenous100 mg/1
Injection, powder, lyophilized, for solutionintravenous400 mg/1
Powder for solutionintravenous100 mg
Powder for solutionintravenous400 mg
PricesNot Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US7612182 No2007-08-012027-08-01Us
Properties
StateSolid
Experimental PropertiesNot Available
References
Synthesis ReferenceNot Available
General References
  1. Puchalski T, Prabhakar U, Jiao Q, Berns B, Davis HM: Pharmacokinetic and pharmacodynamic modeling of an anti-interleukin-6 chimeric monoclonal antibody (siltuximab) in patients with metastatic renal cell carcinoma. Clin Cancer Res. 2010 Mar 1;16(5):1652-61. doi: 10.1158/1078-0432.CCR-09-2581. Epub 2010 Feb 23. [PubMed:20179212 ]
  2. Deisseroth A, Ko CW, Nie L, Zirkelbach JF, Zhao L, Bullock J, Mehrotra N, Del Valle P, Saber H, Sheth C, Gehrke B, Justice R, Farrell A, Pazdur R: FDA approval: siltuximab for the treatment of patients with multicentric Castleman disease. Clin Cancer Res. 2015 Mar 1;21(5):950-4. doi: 10.1158/1078-0432.CCR-14-1678. Epub 2015 Jan 19. [PubMed:25601959 ]
  3. Liu YC, Stone K, van Rhee F: Siltuximab for multicentric Castleman disease. Expert Rev Hematol. 2014 Oct;7(5):545-57. doi: 10.1586/17474086.2014.946402. Epub 2014 Aug 9. [PubMed:25110138 ]
External Links
ATC CodesL04AC11
AHFS Codes
  • 10:00
PDB EntriesNot Available
FDA labelDownload (326 KB)
MSDSNot Available
Interactions
Drug Interactions
Drug
AbirateroneThe serum concentration of Abiraterone can be decreased when it is combined with Siltuximab.
AcenocoumarolThe serum concentration of Acenocoumarol can be decreased when it is combined with Siltuximab.
AcetaminophenThe serum concentration of Acetaminophen can be decreased when it is combined with Siltuximab.
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Siltuximab.
AdinazolamThe serum concentration of Adinazolam can be decreased when it is combined with Siltuximab.
AlbendazoleThe serum concentration of Albendazole can be decreased when it is combined with Siltuximab.
AlclometasoneThe serum concentration of Alclometasone can be decreased when it is combined with Siltuximab.
AlfentanilThe serum concentration of Alfentanil can be decreased when it is combined with Siltuximab.
AlfuzosinThe serum concentration of Alfuzosin can be decreased when it is combined with Siltuximab.
AliskirenThe serum concentration of Aliskiren can be decreased when it is combined with Siltuximab.
AllylestrenolThe serum concentration of Allylestrenol can be decreased when it is combined with Siltuximab.
AlmotriptanThe serum concentration of Almotriptan can be decreased when it is combined with Siltuximab.
AlogliptinThe serum concentration of Alogliptin can be decreased when it is combined with Siltuximab.
AlosetronThe serum concentration of Alosetron can be decreased when it is combined with Siltuximab.
AlprazolamThe serum concentration of Alprazolam can be decreased when it is combined with Siltuximab.
AmbrisentanThe serum concentration of Ambrisentan can be decreased when it is combined with Siltuximab.
AmbroxolThe serum concentration of Ambroxol can be decreased when it is combined with Siltuximab.
AminophenazoneThe serum concentration of Aminophenazone can be decreased when it is combined with Siltuximab.
AminophyllineThe serum concentration of Aminophylline can be decreased when it is combined with Siltuximab.
AmiodaroneThe serum concentration of Amiodarone can be decreased when it is combined with Siltuximab.
AmitriptylineThe serum concentration of Amitriptyline can be decreased when it is combined with Siltuximab.
AmlodipineThe serum concentration of Amlodipine can be decreased when it is combined with Siltuximab.
AmprenavirThe serum concentration of Amprenavir can be decreased when it is combined with Siltuximab.
AntipyrineThe serum concentration of Antipyrine can be decreased when it is combined with Siltuximab.
ApixabanThe serum concentration of Apixaban can be decreased when it is combined with Siltuximab.
ApremilastThe serum concentration of Apremilast can be decreased when it is combined with Siltuximab.
AprepitantThe serum concentration of Aprepitant can be decreased when it is combined with Siltuximab.
ArgatrobanThe serum concentration of Argatroban can be decreased when it is combined with Siltuximab.
AripiprazoleThe serum concentration of Aripiprazole can be decreased when it is combined with Siltuximab.
ArtemetherThe serum concentration of Artemether can be decreased when it is combined with Siltuximab.
AsenapineThe serum concentration of Asenapine can be decreased when it is combined with Siltuximab.
AstemizoleThe serum concentration of Astemizole can be decreased when it is combined with Siltuximab.
AtazanavirThe serum concentration of Atazanavir can be decreased when it is combined with Siltuximab.
AtorvastatinThe serum concentration of Atorvastatin can be decreased when it is combined with Siltuximab.
AvanafilThe serum concentration of Avanafil can be decreased when it is combined with Siltuximab.
AxitinibThe serum concentration of Axitinib can be decreased when it is combined with Siltuximab.
AzelastineThe serum concentration of Azelastine can be decreased when it is combined with Siltuximab.
AzithromycinThe serum concentration of Azithromycin can be decreased when it is combined with Siltuximab.
BanoxantroneThe serum concentration of Banoxantrone can be decreased when it is combined with Siltuximab.
BedaquilineThe serum concentration of Bedaquiline can be decreased when it is combined with Siltuximab.
BenzphetamineThe serum concentration of Benzphetamine can be decreased when it is combined with Siltuximab.
Benzyl alcoholThe serum concentration of Benzyl alcohol can be decreased when it is combined with Siltuximab.
BevacizumabBevacizumab may increase the cardiotoxic activities of Siltuximab.
BexaroteneThe serum concentration of Bexarotene can be decreased when it is combined with Siltuximab.
BezafibrateThe serum concentration of Bezafibrate can be decreased when it is combined with Siltuximab.
BicalutamideThe serum concentration of Bicalutamide can be decreased when it is combined with Siltuximab.
BisoprololThe serum concentration of Bisoprolol can be decreased when it is combined with Siltuximab.
BoceprevirThe serum concentration of Boceprevir can be decreased when it is combined with Siltuximab.
BortezomibThe serum concentration of Bortezomib can be decreased when it is combined with Siltuximab.
BosentanThe serum concentration of Bosentan can be decreased when it is combined with Siltuximab.
BosutinibThe serum concentration of Bosutinib can be decreased when it is combined with Siltuximab.
Brentuximab vedotinThe serum concentration of Brentuximab vedotin can be decreased when it is combined with Siltuximab.
BrexpiprazoleThe serum concentration of Brexpiprazole can be decreased when it is combined with Siltuximab.
BrinzolamideThe serum concentration of Brinzolamide can be decreased when it is combined with Siltuximab.
BromazepamThe serum concentration of Bromazepam can be decreased when it is combined with Siltuximab.
BromocriptineThe serum concentration of Bromocriptine can be decreased when it is combined with Siltuximab.
BrompheniramineThe serum concentration of Brompheniramine can be decreased when it is combined with Siltuximab.
BudesonideThe serum concentration of Budesonide can be decreased when it is combined with Siltuximab.
BupivacaineThe serum concentration of Bupivacaine can be decreased when it is combined with Siltuximab.
BuprenorphineThe serum concentration of Buprenorphine can be decreased when it is combined with Siltuximab.
BupropionThe serum concentration of Bupropion can be decreased when it is combined with Siltuximab.
BuspironeThe serum concentration of Buspirone can be decreased when it is combined with Siltuximab.
BusulfanThe serum concentration of Busulfan can be decreased when it is combined with Siltuximab.
CabazitaxelThe serum concentration of Cabazitaxel can be decreased when it is combined with Siltuximab.
CabazitaxelThe risk or severity of adverse effects can be increased when Cabazitaxel is combined with Siltuximab.
CabergolineThe serum concentration of Cabergoline can be decreased when it is combined with Siltuximab.
CabozantinibThe serum concentration of Cabozantinib can be decreased when it is combined with Siltuximab.
CaffeineThe serum concentration of Caffeine can be decreased when it is combined with Siltuximab.
CalcitriolThe serum concentration of Calcitriol can be decreased when it is combined with Siltuximab.
CanagliflozinThe serum concentration of Canagliflozin can be decreased when it is combined with Siltuximab.
CarbamazepineThe serum concentration of Carbamazepine can be decreased when it is combined with Siltuximab.
CarbinoxamineThe serum concentration of Carbinoxamine can be decreased when it is combined with Siltuximab.
CariprazineThe serum concentration of Cariprazine can be decreased when it is combined with Siltuximab.
CarvedilolThe serum concentration of Carvedilol can be decreased when it is combined with Siltuximab.
CelecoxibThe serum concentration of Celecoxib can be decreased when it is combined with Siltuximab.
CeliprololThe serum concentration of Celiprolol can be decreased when it is combined with Siltuximab.
CephalexinThe serum concentration of Cephalexin can be decreased when it is combined with Siltuximab.
CerivastatinThe serum concentration of Cerivastatin can be decreased when it is combined with Siltuximab.
CevimelineThe serum concentration of Cevimeline can be decreased when it is combined with Siltuximab.
Chenodeoxycholic acidThe serum concentration of Chenodeoxycholic acid can be decreased when it is combined with Siltuximab.
ChlordiazepoxideThe serum concentration of Chlordiazepoxide can be decreased when it is combined with Siltuximab.
ChloroquineThe serum concentration of Chloroquine can be decreased when it is combined with Siltuximab.
ChlorphenamineThe serum concentration of Chlorphenamine can be decreased when it is combined with Siltuximab.
ChlorpromazineThe serum concentration of Chlorpromazine can be decreased when it is combined with Siltuximab.
ChlorzoxazoneThe serum concentration of Chlorzoxazone can be decreased when it is combined with Siltuximab.
CholecalciferolThe serum concentration of Cholecalciferol can be decreased when it is combined with Siltuximab.
CiclesonideThe serum concentration of Ciclesonide can be decreased when it is combined with Siltuximab.
CilostazolThe serum concentration of Cilostazol can be decreased when it is combined with Siltuximab.
CinacalcetThe serum concentration of Cinacalcet can be decreased when it is combined with Siltuximab.
CisaprideThe serum concentration of Cisapride can be decreased when it is combined with Siltuximab.
CitalopramThe serum concentration of Citalopram can be decreased when it is combined with Siltuximab.
ClarithromycinThe serum concentration of Clarithromycin can be decreased when it is combined with Siltuximab.
ClindamycinThe serum concentration of Clindamycin can be decreased when it is combined with Siltuximab.
ClobazamThe serum concentration of Clobazam can be decreased when it is combined with Siltuximab.
ClofazimineThe serum concentration of Clofazimine can be decreased when it is combined with Siltuximab.
ClofibrateThe serum concentration of Clofibrate can be decreased when it is combined with Siltuximab.
clomethiazoleThe serum concentration of clomethiazole can be decreased when it is combined with Siltuximab.
ClomipramineThe serum concentration of Clomipramine can be decreased when it is combined with Siltuximab.
ClonazepamThe serum concentration of Clonazepam can be decreased when it is combined with Siltuximab.
ClonidineThe serum concentration of Clonidine can be decreased when it is combined with Siltuximab.
ClopidogrelThe serum concentration of Clopidogrel can be decreased when it is combined with Siltuximab.
ClorazepateThe serum concentration of Clorazepate can be decreased when it is combined with Siltuximab.
ClotiazepamThe serum concentration of Clotiazepam can be decreased when it is combined with Siltuximab.
ClozapineThe serum concentration of Clozapine can be decreased when it is combined with Siltuximab.
CocaineThe serum concentration of Cocaine can be decreased when it is combined with Siltuximab.
CodeineThe serum concentration of Codeine can be decreased when it is combined with Siltuximab.
ColchicineThe serum concentration of Colchicine can be decreased when it is combined with Siltuximab.
ConivaptanThe serum concentration of Conivaptan can be decreased when it is combined with Siltuximab.
Conjugated Equine EstrogensThe serum concentration of Conjugated Equine Estrogens can be decreased when it is combined with Siltuximab.
Cortisone acetateThe serum concentration of Cortisone acetate can be decreased when it is combined with Siltuximab.
CrizotinibThe serum concentration of Crizotinib can be decreased when it is combined with Siltuximab.
CyclobenzaprineThe serum concentration of Cyclobenzaprine can be decreased when it is combined with Siltuximab.
CyclophosphamideThe serum concentration of Cyclophosphamide can be decreased when it is combined with Siltuximab.
CyclophosphamideCyclophosphamide may increase the cardiotoxic activities of Siltuximab.
CyclosporineThe serum concentration of Cyclosporine can be decreased when it is combined with Siltuximab.
CytarabineThe serum concentration of Cytarabine can be decreased when it is combined with Siltuximab.
DabrafenibThe serum concentration of Dabrafenib can be decreased when it is combined with Siltuximab.
DaclatasvirThe serum concentration of Daclatasvir can be decreased when it is combined with Siltuximab.
DantroleneThe serum concentration of Dantrolene can be decreased when it is combined with Siltuximab.
DapagliflozinThe serum concentration of Dapagliflozin can be decreased when it is combined with Siltuximab.
DapsoneThe serum concentration of Dapsone can be decreased when it is combined with Siltuximab.
DarifenacinThe serum concentration of Darifenacin can be decreased when it is combined with Siltuximab.
DarunavirThe serum concentration of Darunavir can be decreased when it is combined with Siltuximab.
DasabuvirThe serum concentration of Dasabuvir can be decreased when it is combined with Siltuximab.
DasatinibThe serum concentration of Dasatinib can be decreased when it is combined with Siltuximab.
DaunorubicinThe serum concentration of Daunorubicin can be decreased when it is combined with Siltuximab.
DehydroepiandrosteroneThe serum concentration of Dehydroepiandrosterone can be decreased when it is combined with Siltuximab.
DelavirdineThe serum concentration of Delavirdine can be decreased when it is combined with Siltuximab.
DenosumabThe risk or severity of adverse effects can be increased when Denosumab is combined with Siltuximab.
DeslanosideDeslanoside may decrease the cardiotoxic activities of Siltuximab.
DesvenlafaxineThe serum concentration of Desvenlafaxine can be decreased when it is combined with Siltuximab.
DexamethasoneThe serum concentration of Dexamethasone can be decreased when it is combined with Siltuximab.
DextromethorphanThe serum concentration of Dextromethorphan can be decreased when it is combined with Siltuximab.
DextropropoxypheneThe serum concentration of Dextropropoxyphene can be decreased when it is combined with Siltuximab.
DiazepamThe serum concentration of Diazepam can be decreased when it is combined with Siltuximab.
DiclofenacThe serum concentration of Diclofenac can be decreased when it is combined with Siltuximab.
DigitoxinThe serum concentration of Digitoxin can be decreased when it is combined with Siltuximab.
DigitoxinDigitoxin may decrease the cardiotoxic activities of Siltuximab.
DigoxinThe serum concentration of Digoxin can be decreased when it is combined with Siltuximab.
DigoxinDigoxin may decrease the cardiotoxic activities of Siltuximab.
DihydrocodeineThe serum concentration of Dihydrocodeine can be decreased when it is combined with Siltuximab.
DihydroergotamineThe serum concentration of Dihydroergotamine can be decreased when it is combined with Siltuximab.
DiltiazemThe serum concentration of Diltiazem can be decreased when it is combined with Siltuximab.
DisopyramideThe serum concentration of Disopyramide can be decreased when it is combined with Siltuximab.
DisulfiramThe serum concentration of Disulfiram can be decreased when it is combined with Siltuximab.
DocetaxelThe serum concentration of Docetaxel can be decreased when it is combined with Siltuximab.
DocetaxelThe risk or severity of adverse effects can be increased when Docetaxel is combined with Siltuximab.
DofetilideThe serum concentration of Dofetilide can be decreased when it is combined with Siltuximab.
DolasetronThe serum concentration of Dolasetron can be decreased when it is combined with Siltuximab.
DomperidoneThe serum concentration of Domperidone can be decreased when it is combined with Siltuximab.
DonepezilThe serum concentration of Donepezil can be decreased when it is combined with Siltuximab.
DorzolamideThe serum concentration of Dorzolamide can be decreased when it is combined with Siltuximab.
DoxepinThe serum concentration of Doxepin can be decreased when it is combined with Siltuximab.
DoxorubicinThe serum concentration of Doxorubicin can be decreased when it is combined with Siltuximab.
DronabinolThe serum concentration of Dronabinol can be decreased when it is combined with Siltuximab.
DronedaroneThe serum concentration of Dronedarone can be decreased when it is combined with Siltuximab.
DutasterideThe serum concentration of Dutasteride can be decreased when it is combined with Siltuximab.
EfavirenzThe serum concentration of Efavirenz can be decreased when it is combined with Siltuximab.
EletriptanThe serum concentration of Eletriptan can be decreased when it is combined with Siltuximab.
EliglustatThe serum concentration of Eliglustat can be decreased when it is combined with Siltuximab.
ElvitegravirThe serum concentration of Elvitegravir can be decreased when it is combined with Siltuximab.
EnalaprilThe serum concentration of Enalapril can be decreased when it is combined with Siltuximab.
EnzalutamideThe serum concentration of Enzalutamide can be decreased when it is combined with Siltuximab.
EpinastineThe serum concentration of Epinastine can be decreased when it is combined with Siltuximab.
EplerenoneThe serum concentration of Eplerenone can be decreased when it is combined with Siltuximab.
ErgocalciferolThe serum concentration of Ergocalciferol can be decreased when it is combined with Siltuximab.
Ergoloid mesylateThe serum concentration of Ergoloid mesylate can be decreased when it is combined with Siltuximab.
ErgonovineThe serum concentration of Ergonovine can be decreased when it is combined with Siltuximab.
ErgotamineThe serum concentration of Ergotamine can be decreased when it is combined with Siltuximab.
ErlotinibThe serum concentration of Erlotinib can be decreased when it is combined with Siltuximab.
ErythromycinThe serum concentration of Erythromycin can be decreased when it is combined with Siltuximab.
EscitalopramThe serum concentration of Escitalopram can be decreased when it is combined with Siltuximab.
EsomeprazoleThe serum concentration of Esomeprazole can be decreased when it is combined with Siltuximab.
EstazolamThe serum concentration of Estazolam can be decreased when it is combined with Siltuximab.
EstradiolThe serum concentration of Estradiol can be decreased when it is combined with Siltuximab.
Estradiol valerate/DienogestThe serum concentration of Estradiol valerate/Dienogest can be decreased when it is combined with Siltuximab.
EstramustineThe serum concentration of Estramustine can be decreased when it is combined with Siltuximab.
EstroneThe serum concentration of Estrone can be decreased when it is combined with Siltuximab.
Estrone sulfateThe serum concentration of Estrone sulfate can be decreased when it is combined with Siltuximab.
EszopicloneThe serum concentration of Eszopiclone can be decreased when it is combined with Siltuximab.
EthanolThe serum concentration of Ethanol can be decreased when it is combined with Siltuximab.
Ethinyl EstradiolThe serum concentration of Ethinyl Estradiol can be decreased when it is combined with Siltuximab.
EthosuximideThe serum concentration of Ethosuximide can be decreased when it is combined with Siltuximab.
EthylmorphineThe serum concentration of Ethylmorphine can be decreased when it is combined with Siltuximab.
EtonogestrelThe serum concentration of Etonogestrel can be decreased when it is combined with Siltuximab.
EtoposideThe serum concentration of Etoposide can be decreased when it is combined with Siltuximab.
EtoricoxibThe serum concentration of Etoricoxib can be decreased when it is combined with Siltuximab.
EtravirineThe serum concentration of Etravirine can be decreased when it is combined with Siltuximab.
EverolimusThe serum concentration of Everolimus can be decreased when it is combined with Siltuximab.
ExemestaneThe serum concentration of Exemestane can be decreased when it is combined with Siltuximab.
FamciclovirThe serum concentration of Famciclovir can be decreased when it is combined with Siltuximab.
FelbamateThe serum concentration of Felbamate can be decreased when it is combined with Siltuximab.
FelodipineThe serum concentration of Felodipine can be decreased when it is combined with Siltuximab.
FenofibrateThe serum concentration of Fenofibrate can be decreased when it is combined with Siltuximab.
FentanylThe serum concentration of Fentanyl can be decreased when it is combined with Siltuximab.
FesoterodineThe serum concentration of Fesoterodine can be decreased when it is combined with Siltuximab.
FinasterideThe serum concentration of Finasteride can be decreased when it is combined with Siltuximab.
FingolimodThe serum concentration of Fingolimod can be decreased when it is combined with Siltuximab.
FlibanserinThe serum concentration of Flibanserin can be decreased when it is combined with Siltuximab.
FlunisolideThe serum concentration of Flunisolide can be decreased when it is combined with Siltuximab.
FlunitrazepamThe serum concentration of Flunitrazepam can be decreased when it is combined with Siltuximab.
FluorometholoneThe serum concentration of Fluorometholone can be decreased when it is combined with Siltuximab.
FluoxetineThe serum concentration of Fluoxetine can be decreased when it is combined with Siltuximab.
FlurazepamThe serum concentration of Flurazepam can be decreased when it is combined with Siltuximab.
FlutamideThe serum concentration of Flutamide can be decreased when it is combined with Siltuximab.
Fluticasone furoateThe serum concentration of Fluticasone furoate can be decreased when it is combined with Siltuximab.
Fluticasone PropionateThe serum concentration of Fluticasone Propionate can be decreased when it is combined with Siltuximab.
FluvastatinThe serum concentration of Fluvastatin can be decreased when it is combined with Siltuximab.
FosamprenavirThe serum concentration of Fosamprenavir can be decreased when it is combined with Siltuximab.
FulvestrantThe serum concentration of Fulvestrant can be decreased when it is combined with Siltuximab.
GalantamineThe serum concentration of Galantamine can be decreased when it is combined with Siltuximab.
GefitinibThe serum concentration of Gefitinib can be decreased when it is combined with Siltuximab.
GemfibrozilThe serum concentration of Gemfibrozil can be decreased when it is combined with Siltuximab.
GlipizideThe serum concentration of Glipizide can be decreased when it is combined with Siltuximab.
GlyburideThe serum concentration of Glyburide can be decreased when it is combined with Siltuximab.
GranisetronThe serum concentration of Granisetron can be decreased when it is combined with Siltuximab.
GrepafloxacinThe serum concentration of Grepafloxacin can be decreased when it is combined with Siltuximab.
GuanfacineThe serum concentration of Guanfacine can be decreased when it is combined with Siltuximab.
HalofantrineThe serum concentration of Halofantrine can be decreased when it is combined with Siltuximab.
HaloperidolThe serum concentration of Haloperidol can be decreased when it is combined with Siltuximab.
HalothaneThe serum concentration of Halothane can be decreased when it is combined with Siltuximab.
HexobarbitalThe serum concentration of Hexobarbital can be decreased when it is combined with Siltuximab.
Histamine PhosphateThe serum concentration of Histamine Phosphate can be decreased when it is combined with Siltuximab.
HydrocodoneThe serum concentration of Hydrocodone can be decreased when it is combined with Siltuximab.
HydrocortisoneThe serum concentration of Hydrocortisone can be decreased when it is combined with Siltuximab.
HydromorphoneThe serum concentration of Hydromorphone can be decreased when it is combined with Siltuximab.
Hydroxyprogesterone caproateThe serum concentration of Hydroxyprogesterone caproate can be decreased when it is combined with Siltuximab.
IbrutinibThe serum concentration of Ibrutinib can be decreased when it is combined with Siltuximab.
IfosfamideThe serum concentration of Ifosfamide can be decreased when it is combined with Siltuximab.
IloperidoneThe serum concentration of Iloperidone can be decreased when it is combined with Siltuximab.
ImatinibThe serum concentration of Imatinib can be decreased when it is combined with Siltuximab.
ImipramineThe serum concentration of Imipramine can be decreased when it is combined with Siltuximab.
ImiquimodThe serum concentration of Imiquimod can be decreased when it is combined with Siltuximab.
IndacaterolThe serum concentration of Indacaterol can be decreased when it is combined with Siltuximab.
IndapamideThe serum concentration of Indapamide can be decreased when it is combined with Siltuximab.
IndinavirThe serum concentration of Indinavir can be decreased when it is combined with Siltuximab.
Ipratropium bromideThe serum concentration of Ipratropium bromide can be decreased when it is combined with Siltuximab.
IrinotecanThe serum concentration of Irinotecan can be decreased when it is combined with Siltuximab.
IsavuconazoniumThe serum concentration of Isavuconazonium can be decreased when it is combined with Siltuximab.
Isosorbide DinitrateThe serum concentration of Isosorbide Dinitrate can be decreased when it is combined with Siltuximab.
Isosorbide MononitrateThe serum concentration of Isosorbide Mononitrate can be decreased when it is combined with Siltuximab.
IsradipineThe serum concentration of Isradipine can be decreased when it is combined with Siltuximab.
ItraconazoleThe serum concentration of Itraconazole can be decreased when it is combined with Siltuximab.
IvabradineThe serum concentration of Ivabradine can be decreased when it is combined with Siltuximab.
IvacaftorThe serum concentration of Ivacaftor can be decreased when it is combined with Siltuximab.
IvermectinThe serum concentration of Ivermectin can be decreased when it is combined with Siltuximab.
IxabepiloneThe serum concentration of Ixabepilone can be decreased when it is combined with Siltuximab.
IxazomibThe serum concentration of Ixazomib can be decreased when it is combined with Siltuximab.
KetamineThe serum concentration of Ketamine can be decreased when it is combined with Siltuximab.
KetazolamThe serum concentration of Ketazolam can be decreased when it is combined with Siltuximab.
KetobemidoneThe serum concentration of Ketobemidone can be decreased when it is combined with Siltuximab.
KetoconazoleThe serum concentration of Ketoconazole can be decreased when it is combined with Siltuximab.
LansoprazoleThe serum concentration of Lansoprazole can be decreased when it is combined with Siltuximab.
LapatinibThe serum concentration of Lapatinib can be decreased when it is combined with Siltuximab.
LaquinimodThe serum concentration of Laquinimod can be decreased when it is combined with Siltuximab.
LeflunomideThe risk or severity of adverse effects can be increased when Siltuximab is combined with Leflunomide.
LenvatinibThe serum concentration of Lenvatinib can be decreased when it is combined with Siltuximab.
LercanidipineThe serum concentration of Lercanidipine can be decreased when it is combined with Siltuximab.
LetrozoleThe serum concentration of Letrozole can be decreased when it is combined with Siltuximab.
LevobupivacaineThe serum concentration of Levobupivacaine can be decreased when it is combined with Siltuximab.
LevocetirizineThe serum concentration of Levocetirizine can be decreased when it is combined with Siltuximab.
Levomethadyl AcetateThe serum concentration of Levomethadyl Acetate can be decreased when it is combined with Siltuximab.
LevomilnacipranThe serum concentration of Levomilnacipran can be decreased when it is combined with Siltuximab.
LevonorgestrelThe serum concentration of Levonorgestrel can be decreased when it is combined with Siltuximab.
LevothyroxineThe serum concentration of Levothyroxine can be decreased when it is combined with Siltuximab.
LidocaineThe serum concentration of Lidocaine can be decreased when it is combined with Siltuximab.
LisurideThe serum concentration of Lisuride can be decreased when it is combined with Siltuximab.
LomitapideThe serum concentration of Lomitapide can be decreased when it is combined with Siltuximab.
LoperamideThe serum concentration of Loperamide can be decreased when it is combined with Siltuximab.
LopinavirThe serum concentration of Lopinavir can be decreased when it is combined with Siltuximab.
LoratadineThe serum concentration of Loratadine can be decreased when it is combined with Siltuximab.
LorcaserinThe serum concentration of Lorcaserin can be decreased when it is combined with Siltuximab.
LosartanThe serum concentration of Losartan can be decreased when it is combined with Siltuximab.
LovastatinThe serum concentration of Lovastatin can be decreased when it is combined with Siltuximab.
LumefantrineThe serum concentration of Lumefantrine can be decreased when it is combined with Siltuximab.
LurasidoneThe serum concentration of Lurasidone can be decreased when it is combined with Siltuximab.
MacitentanThe serum concentration of Macitentan can be decreased when it is combined with Siltuximab.
MaravirocThe serum concentration of Maraviroc can be decreased when it is combined with Siltuximab.
MebendazoleThe serum concentration of Mebendazole can be decreased when it is combined with Siltuximab.
Medroxyprogesterone acetateThe serum concentration of Medroxyprogesterone acetate can be decreased when it is combined with Siltuximab.
MefloquineThe serum concentration of Mefloquine can be decreased when it is combined with Siltuximab.
MeloxicamThe serum concentration of Meloxicam can be decreased when it is combined with Siltuximab.
MethadoneThe serum concentration of Methadone can be decreased when it is combined with Siltuximab.
MethaqualoneThe serum concentration of Methaqualone can be decreased when it is combined with Siltuximab.
MethoxsalenThe serum concentration of Methoxsalen can be decreased when it is combined with Siltuximab.
MethoxyfluraneThe serum concentration of Methoxyflurane can be decreased when it is combined with Siltuximab.
MethylprednisoloneThe serum concentration of Methylprednisolone can be decreased when it is combined with Siltuximab.
MethyltestosteroneThe serum concentration of Methyltestosterone can be decreased when it is combined with Siltuximab.
MetronidazoleThe serum concentration of Metronidazole can be decreased when it is combined with Siltuximab.
MexiletineThe serum concentration of Mexiletine can be decreased when it is combined with Siltuximab.
MianserinThe serum concentration of Mianserin can be decreased when it is combined with Siltuximab.
MibefradilThe serum concentration of Mibefradil can be decreased when it is combined with Siltuximab.
MiconazoleThe serum concentration of Miconazole can be decreased when it is combined with Siltuximab.
MidazolamThe serum concentration of Midazolam can be decreased when it is combined with Siltuximab.
MifepristoneThe serum concentration of Mifepristone can be decreased when it is combined with Siltuximab.
MirabegronThe serum concentration of Mirabegron can be decreased when it is combined with Siltuximab.
MirtazapineThe serum concentration of Mirtazapine can be decreased when it is combined with Siltuximab.
ModafinilThe serum concentration of Modafinil can be decreased when it is combined with Siltuximab.
MontelukastThe serum concentration of Montelukast can be decreased when it is combined with Siltuximab.
MorphineThe serum concentration of Morphine can be decreased when it is combined with Siltuximab.
Mycophenolate mofetilThe serum concentration of Mycophenolate mofetil can be decreased when it is combined with Siltuximab.
NaloxegolThe serum concentration of Naloxegol can be decreased when it is combined with Siltuximab.
NaloxoneThe serum concentration of Naloxone can be decreased when it is combined with Siltuximab.
NatalizumabThe risk or severity of adverse effects can be increased when Siltuximab is combined with Natalizumab.
NateglinideThe serum concentration of Nateglinide can be decreased when it is combined with Siltuximab.
NefazodoneThe serum concentration of Nefazodone can be decreased when it is combined with Siltuximab.
NelfinavirThe serum concentration of Nelfinavir can be decreased when it is combined with Siltuximab.
NevirapineThe serum concentration of Nevirapine can be decreased when it is combined with Siltuximab.
NicardipineThe serum concentration of Nicardipine can be decreased when it is combined with Siltuximab.
NicotineThe serum concentration of Nicotine can be decreased when it is combined with Siltuximab.
NifedipineThe serum concentration of Nifedipine can be decreased when it is combined with Siltuximab.
NilotinibThe serum concentration of Nilotinib can be decreased when it is combined with Siltuximab.
NilvadipineThe serum concentration of Nilvadipine can be decreased when it is combined with Siltuximab.
NimodipineThe serum concentration of Nimodipine can be decreased when it is combined with Siltuximab.
NisoldipineThe serum concentration of Nisoldipine can be decreased when it is combined with Siltuximab.
NitrazepamThe serum concentration of Nitrazepam can be decreased when it is combined with Siltuximab.
NitrendipineThe serum concentration of Nitrendipine can be decreased when it is combined with Siltuximab.
NorethisteroneThe serum concentration of Norethisterone can be decreased when it is combined with Siltuximab.
NorgestrelThe serum concentration of Norgestrel can be decreased when it is combined with Siltuximab.
NortriptylineThe serum concentration of Nortriptyline can be decreased when it is combined with Siltuximab.
OlaparibThe serum concentration of Olaparib can be decreased when it is combined with Siltuximab.
OlopatadineThe serum concentration of Olopatadine can be decreased when it is combined with Siltuximab.
OmeprazoleThe serum concentration of Omeprazole can be decreased when it is combined with Siltuximab.
OndansetronThe serum concentration of Ondansetron can be decreased when it is combined with Siltuximab.
OrphenadrineThe serum concentration of Orphenadrine can be decreased when it is combined with Siltuximab.
OspemifeneThe serum concentration of Ospemifene can be decreased when it is combined with Siltuximab.
OuabainOuabain may decrease the cardiotoxic activities of Siltuximab.
OxazepamThe serum concentration of Oxazepam can be decreased when it is combined with Siltuximab.
OxybutyninThe serum concentration of Oxybutynin can be decreased when it is combined with Siltuximab.
OxycodoneThe serum concentration of Oxycodone can be decreased when it is combined with Siltuximab.
OxymorphoneThe serum concentration of Oxymorphone can be decreased when it is combined with Siltuximab.
PaclitaxelThe serum concentration of Paclitaxel can be decreased when it is combined with Siltuximab.
PaclitaxelThe risk or severity of adverse effects can be increased when Paclitaxel is combined with Siltuximab.
PalbociclibThe serum concentration of Palbociclib can be decreased when it is combined with Siltuximab.
PalonosetronThe serum concentration of Palonosetron can be decreased when it is combined with Siltuximab.
PanobinostatThe serum concentration of Panobinostat can be decreased when it is combined with Siltuximab.
PantoprazoleThe serum concentration of Pantoprazole can be decreased when it is combined with Siltuximab.
ParamethadioneThe serum concentration of Paramethadione can be decreased when it is combined with Siltuximab.
ParamethasoneThe serum concentration of Paramethasone can be decreased when it is combined with Siltuximab.
ParecoxibThe serum concentration of Parecoxib can be decreased when it is combined with Siltuximab.
ParicalcitolThe serum concentration of Paricalcitol can be decreased when it is combined with Siltuximab.
ParitaprevirThe serum concentration of Paritaprevir can be decreased when it is combined with Siltuximab.
PazopanibThe serum concentration of Pazopanib can be decreased when it is combined with Siltuximab.
PentamidineThe serum concentration of Pentamidine can be decreased when it is combined with Siltuximab.
PerampanelThe serum concentration of Perampanel can be decreased when it is combined with Siltuximab.
PergolideThe serum concentration of Pergolide can be decreased when it is combined with Siltuximab.
PerhexilineThe serum concentration of Perhexiline can be decreased when it is combined with Siltuximab.
PermethrinThe serum concentration of Permethrin can be decreased when it is combined with Siltuximab.
PerphenazineThe serum concentration of Perphenazine can be decreased when it is combined with Siltuximab.
PethidineThe serum concentration of Pethidine can be decreased when it is combined with Siltuximab.
PhenacetinThe serum concentration of Phenacetin can be decreased when it is combined with Siltuximab.
PhenoxybenzamineThe serum concentration of Phenoxybenzamine can be decreased when it is combined with Siltuximab.
PhenprocoumonThe serum concentration of Phenprocoumon can be decreased when it is combined with Siltuximab.
PhenytoinThe serum concentration of Phenytoin can be decreased when it is combined with Siltuximab.
PilocarpineThe serum concentration of Pilocarpine can be decreased when it is combined with Siltuximab.
PimecrolimusThe risk or severity of adverse effects can be increased when Pimecrolimus is combined with Siltuximab.
PimecrolimusThe serum concentration of Pimecrolimus can be decreased when it is combined with Siltuximab.
PimozideThe serum concentration of Pimozide can be decreased when it is combined with Siltuximab.
PinacidilThe serum concentration of Pinacidil can be decreased when it is combined with Siltuximab.
PioglitazoneThe serum concentration of Pioglitazone can be decreased when it is combined with Siltuximab.
PipotiazineThe serum concentration of Pipotiazine can be decreased when it is combined with Siltuximab.
PodofiloxThe serum concentration of Podofilox can be decreased when it is combined with Siltuximab.
PomalidomideThe serum concentration of Pomalidomide can be decreased when it is combined with Siltuximab.
PonatinibThe serum concentration of Ponatinib can be decreased when it is combined with Siltuximab.
PosaconazoleThe serum concentration of Posaconazole can be decreased when it is combined with Siltuximab.
PrasugrelThe serum concentration of Prasugrel can be decreased when it is combined with Siltuximab.
PravastatinThe serum concentration of Pravastatin can be decreased when it is combined with Siltuximab.
PrazepamThe serum concentration of Prazepam can be decreased when it is combined with Siltuximab.
PraziquantelThe serum concentration of Praziquantel can be decreased when it is combined with Siltuximab.
PrednisoloneThe serum concentration of Prednisolone can be decreased when it is combined with Siltuximab.
PrednisoneThe serum concentration of Prednisone can be decreased when it is combined with Siltuximab.
PrimaquineThe serum concentration of Primaquine can be decreased when it is combined with Siltuximab.
ProchlorperazineThe serum concentration of Prochlorperazine can be decreased when it is combined with Siltuximab.
ProgesteroneThe serum concentration of Progesterone can be decreased when it is combined with Siltuximab.
ProguanilThe serum concentration of Proguanil can be decreased when it is combined with Siltuximab.
PromazineThe serum concentration of Promazine can be decreased when it is combined with Siltuximab.
PropafenoneThe serum concentration of Propafenone can be decreased when it is combined with Siltuximab.
PropofolThe serum concentration of Propofol can be decreased when it is combined with Siltuximab.
PropranololThe serum concentration of Propranolol can be decreased when it is combined with Siltuximab.
PyrazinamideThe serum concentration of Pyrazinamide can be decreased when it is combined with Siltuximab.
QuazepamThe serum concentration of Quazepam can be decreased when it is combined with Siltuximab.
QuetiapineThe serum concentration of Quetiapine can be decreased when it is combined with Siltuximab.
QuinacrineThe serum concentration of Quinacrine can be decreased when it is combined with Siltuximab.
QuinidineThe serum concentration of Quinidine can be decreased when it is combined with Siltuximab.
QuinineThe serum concentration of Quinine can be decreased when it is combined with Siltuximab.
RabeprazoleThe serum concentration of Rabeprazole can be decreased when it is combined with Siltuximab.
Rabies vaccineThe risk or severity of adverse effects can be increased when Siltuximab is combined with Rabies vaccine.
RaloxifeneThe serum concentration of Raloxifene can be decreased when it is combined with Siltuximab.
RamelteonThe serum concentration of Ramelteon can be decreased when it is combined with Siltuximab.
RanolazineThe serum concentration of Ranolazine can be decreased when it is combined with Siltuximab.
ReboxetineThe serum concentration of Reboxetine can be decreased when it is combined with Siltuximab.
RegorafenibThe serum concentration of Regorafenib can be decreased when it is combined with Siltuximab.
RepaglinideThe serum concentration of Repaglinide can be decreased when it is combined with Siltuximab.
RetapamulinThe serum concentration of Retapamulin can be decreased when it is combined with Siltuximab.
RifabutinThe serum concentration of Rifabutin can be decreased when it is combined with Siltuximab.
RifampicinThe serum concentration of Rifampicin can be decreased when it is combined with Siltuximab.
RilpivirineThe serum concentration of Rilpivirine can be decreased when it is combined with Siltuximab.
RimonabantThe serum concentration of Rimonabant can be decreased when it is combined with Siltuximab.
RiociguatThe serum concentration of Riociguat can be decreased when it is combined with Siltuximab.
RisperidoneThe serum concentration of Risperidone can be decreased when it is combined with Siltuximab.
RitonavirThe serum concentration of Ritonavir can be decreased when it is combined with Siltuximab.
RivaroxabanThe serum concentration of Rivaroxaban can be decreased when it is combined with Siltuximab.
RofecoxibThe serum concentration of Rofecoxib can be decreased when it is combined with Siltuximab.
RoflumilastRoflumilast may increase the immunosuppressive activities of Siltuximab.
RolapitantThe serum concentration of Rolapitant can be decreased when it is combined with Siltuximab.
RomidepsinThe serum concentration of Romidepsin can be decreased when it is combined with Siltuximab.
RopiniroleThe serum concentration of Ropinirole can be decreased when it is combined with Siltuximab.
RopivacaineThe serum concentration of Ropivacaine can be decreased when it is combined with Siltuximab.
RosuvastatinThe serum concentration of Rosuvastatin can be decreased when it is combined with Siltuximab.
RotigotineThe serum concentration of Rotigotine can be decreased when it is combined with Siltuximab.
RoxithromycinThe serum concentration of Roxithromycin can be decreased when it is combined with Siltuximab.
RuxolitinibThe serum concentration of Ruxolitinib can be decreased when it is combined with Siltuximab.
SalmeterolThe serum concentration of Salmeterol can be decreased when it is combined with Siltuximab.
SaquinavirThe serum concentration of Saquinavir can be decreased when it is combined with Siltuximab.
SaxagliptinThe serum concentration of Saxagliptin can be decreased when it is combined with Siltuximab.
SelegilineThe serum concentration of Selegiline can be decreased when it is combined with Siltuximab.
SelexipagThe serum concentration of Selexipag can be decreased when it is combined with Siltuximab.
SeratrodastThe serum concentration of Seratrodast can be decreased when it is combined with Siltuximab.
SertindoleThe serum concentration of Sertindole can be decreased when it is combined with Siltuximab.
SertralineThe serum concentration of Sertraline can be decreased when it is combined with Siltuximab.
SevofluraneThe serum concentration of Sevoflurane can be decreased when it is combined with Siltuximab.
SibutramineThe serum concentration of Sibutramine can be decreased when it is combined with Siltuximab.
SildenafilThe serum concentration of Sildenafil can be decreased when it is combined with Siltuximab.
SilodosinThe serum concentration of Silodosin can be decreased when it is combined with Siltuximab.
SimeprevirThe serum concentration of Simeprevir can be decreased when it is combined with Siltuximab.
SimvastatinThe serum concentration of Simvastatin can be decreased when it is combined with Siltuximab.
Sipuleucel-TThe therapeutic efficacy of Sipuleucel-T can be decreased when used in combination with Siltuximab.
SirolimusThe serum concentration of Sirolimus can be decreased when it is combined with Siltuximab.
SitagliptinThe serum concentration of Sitagliptin can be decreased when it is combined with Siltuximab.
SolifenacinThe serum concentration of Solifenacin can be decreased when it is combined with Siltuximab.
SonidegibThe serum concentration of Sonidegib can be decreased when it is combined with Siltuximab.
SorafenibThe serum concentration of Sorafenib can be decreased when it is combined with Siltuximab.
SpiramycinThe serum concentration of Spiramycin can be decreased when it is combined with Siltuximab.
SufentanilThe serum concentration of Sufentanil can be decreased when it is combined with Siltuximab.
SulfadiazineThe serum concentration of Sulfadiazine can be decreased when it is combined with Siltuximab.
SulfamethoxazoleThe serum concentration of Sulfamethoxazole can be decreased when it is combined with Siltuximab.
SulfinpyrazoneThe serum concentration of Sulfinpyrazone can be decreased when it is combined with Siltuximab.
SunitinibThe serum concentration of Sunitinib can be decreased when it is combined with Siltuximab.
Synthetic Conjugated Estrogens, AThe serum concentration of Synthetic Conjugated Estrogens, A can be decreased when it is combined with Siltuximab.
Synthetic Conjugated Estrogens, BThe serum concentration of Synthetic Conjugated Estrogens, B can be decreased when it is combined with Siltuximab.
TacrolimusThe serum concentration of Tacrolimus can be decreased when it is combined with Siltuximab.
TacrolimusThe risk or severity of adverse effects can be increased when Tacrolimus is combined with Siltuximab.
TadalafilThe serum concentration of Tadalafil can be decreased when it is combined with Siltuximab.
TamoxifenThe serum concentration of Tamoxifen can be decreased when it is combined with Siltuximab.
TamsulosinThe serum concentration of Tamsulosin can be decreased when it is combined with Siltuximab.
TasosartanThe serum concentration of Tasosartan can be decreased when it is combined with Siltuximab.
Taurochenodeoxycholic acidThe serum concentration of Taurochenodeoxycholic acid can be decreased when it is combined with Siltuximab.
TelaprevirThe serum concentration of Telaprevir can be decreased when it is combined with Siltuximab.
TelithromycinThe serum concentration of Telithromycin can be decreased when it is combined with Siltuximab.
TemazepamThe serum concentration of Temazepam can be decreased when it is combined with Siltuximab.
TemsirolimusThe serum concentration of Temsirolimus can be decreased when it is combined with Siltuximab.
TeniposideThe serum concentration of Teniposide can be decreased when it is combined with Siltuximab.
TerbinafineThe serum concentration of Terbinafine can be decreased when it is combined with Siltuximab.
TerfenadineThe serum concentration of Terfenadine can be decreased when it is combined with Siltuximab.
TesmilifeneThe serum concentration of Tesmilifene can be decreased when it is combined with Siltuximab.
TestosteroneThe serum concentration of Testosterone can be decreased when it is combined with Siltuximab.
TetracyclineThe serum concentration of Tetracycline can be decreased when it is combined with Siltuximab.
TheophyllineThe serum concentration of Theophylline can be decreased when it is combined with Siltuximab.
ThiotepaThe serum concentration of Thiotepa can be decreased when it is combined with Siltuximab.
TiagabineThe serum concentration of Tiagabine can be decreased when it is combined with Siltuximab.
TicagrelorThe serum concentration of Ticagrelor can be decreased when it is combined with Siltuximab.
TiclopidineThe serum concentration of Ticlopidine can be decreased when it is combined with Siltuximab.
TinidazoleThe serum concentration of Tinidazole can be decreased when it is combined with Siltuximab.
TiotropiumThe serum concentration of Tiotropium can be decreased when it is combined with Siltuximab.
TipranavirThe serum concentration of Tipranavir can be decreased when it is combined with Siltuximab.
TofacitinibSiltuximab may increase the immunosuppressive activities of Tofacitinib.
TolterodineThe serum concentration of Tolterodine can be decreased when it is combined with Siltuximab.
TolvaptanThe serum concentration of Tolvaptan can be decreased when it is combined with Siltuximab.
ToremifeneThe serum concentration of Toremifene can be decreased when it is combined with Siltuximab.
TrabectedinThe serum concentration of Trabectedin can be decreased when it is combined with Siltuximab.
TramadolThe serum concentration of Tramadol can be decreased when it is combined with Siltuximab.
TrastuzumabTrastuzumab may increase the neutropenic activities of Siltuximab.
Trastuzumab emtansineThe serum concentration of Trastuzumab emtansine can be decreased when it is combined with Siltuximab.
TrazodoneThe serum concentration of Trazodone can be decreased when it is combined with Siltuximab.
TretinoinThe serum concentration of Tretinoin can be decreased when it is combined with Siltuximab.
TriamcinoloneThe serum concentration of Triamcinolone can be decreased when it is combined with Siltuximab.
TriazolamThe serum concentration of Triazolam can be decreased when it is combined with Siltuximab.
TrimethadioneThe serum concentration of Trimethadione can be decreased when it is combined with Siltuximab.
TrimethoprimThe serum concentration of Trimethoprim can be decreased when it is combined with Siltuximab.
TrimipramineThe serum concentration of Trimipramine can be decreased when it is combined with Siltuximab.
TroglitazoneThe serum concentration of Troglitazone can be decreased when it is combined with Siltuximab.
TroleandomycinThe serum concentration of Troleandomycin can be decreased when it is combined with Siltuximab.
UdenafilThe serum concentration of Udenafil can be decreased when it is combined with Siltuximab.
UlipristalThe serum concentration of Ulipristal can be decreased when it is combined with Siltuximab.
ValdecoxibThe serum concentration of Valdecoxib can be decreased when it is combined with Siltuximab.
VandetanibThe serum concentration of Vandetanib can be decreased when it is combined with Siltuximab.
VanoxerineThe serum concentration of Vanoxerine can be decreased when it is combined with Siltuximab.
VardenafilThe serum concentration of Vardenafil can be decreased when it is combined with Siltuximab.
VemurafenibThe serum concentration of Vemurafenib can be decreased when it is combined with Siltuximab.
VenlafaxineThe serum concentration of Venlafaxine can be decreased when it is combined with Siltuximab.
VerapamilThe serum concentration of Verapamil can be decreased when it is combined with Siltuximab.
VicrivirocThe serum concentration of Vicriviroc can be decreased when it is combined with Siltuximab.
VilanterolThe serum concentration of Vilanterol can be decreased when it is combined with Siltuximab.
VilazodoneThe serum concentration of Vilazodone can be decreased when it is combined with Siltuximab.
VinblastineThe serum concentration of Vinblastine can be decreased when it is combined with Siltuximab.
VincristineThe serum concentration of Vincristine can be decreased when it is combined with Siltuximab.
VindesineThe serum concentration of Vindesine can be decreased when it is combined with Siltuximab.
VinorelbineThe serum concentration of Vinorelbine can be decreased when it is combined with Siltuximab.
VismodegibThe serum concentration of Vismodegib can be decreased when it is combined with Siltuximab.
VoriconazoleThe serum concentration of Voriconazole can be decreased when it is combined with Siltuximab.
VortioxetineThe serum concentration of Vortioxetine can be decreased when it is combined with Siltuximab.
WarfarinThe serum concentration of Warfarin can be decreased when it is combined with Siltuximab.
YohimbineThe serum concentration of Yohimbine can be decreased when it is combined with Siltuximab.
ZafirlukastThe serum concentration of Zafirlukast can be decreased when it is combined with Siltuximab.
ZalcitabineThe serum concentration of Zalcitabine can be decreased when it is combined with Siltuximab.
ZaleplonThe serum concentration of Zaleplon can be decreased when it is combined with Siltuximab.
ZidovudineThe serum concentration of Zidovudine can be decreased when it is combined with Siltuximab.
ZileutonThe serum concentration of Zileuton can be decreased when it is combined with Siltuximab.
ZiprasidoneThe serum concentration of Ziprasidone can be decreased when it is combined with Siltuximab.
ZolpidemThe serum concentration of Zolpidem can be decreased when it is combined with Siltuximab.
ZomepiracThe serum concentration of Zomepirac can be decreased when it is combined with Siltuximab.
ZonisamideThe serum concentration of Zonisamide can be decreased when it is combined with Siltuximab.
ZopicloneThe serum concentration of Zopiclone can be decreased when it is combined with Siltuximab.
Food InteractionsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
antagonistantibody
General Function:
Interleukin-6 receptor binding
Specific Function:
Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T(H)17 cells. Also acts as ...
Gene Name:
IL6
Uniprot ID:
P05231
Molecular Weight:
23717.965 Da
References
  1. van Zaanen HC, Koopmans RP, Aarden LA, Rensink HJ, Stouthard JM, Warnaar SO, Lokhorst HM, van Oers MH: Endogenous interleukin 6 production in multiple myeloma patients treated with chimeric monoclonal anti-IL6 antibodies indicates the existence of a positive feed-back loop. J Clin Invest. 1996 Sep 15;98(6):1441-8. [PubMed:8823310 ]
Comments
comments powered by Disqus
Drug created on March 16, 2015 13:35 / Updated on August 17, 2016 12:24