Fibroblast growth factor 4
Details
- Name
- Fibroblast growth factor 4
- Synonyms
- FGF-4
- HBGF-4
- Heparin secretory-transforming protein 1
- Heparin-binding growth factor 4
- HST
- HST-1
- HSTF-1
- HSTF1
- KS3
- Transforming protein KS3
- Gene Name
- FGF4
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0000649|Fibroblast growth factor 4 MSGPGTAAVALLPAVLLALLAPWAGRGGAAAPTAPNGTLEAELERRWESLVALSLARLPV AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSP VERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIA LSKNGKTKKGNRVSPTMKVTHFLPRL
- Number of residues
- 206
- Molecular Weight
- 22047.355
- Theoretical pI
- 10.19
- GO Classification
- Functionsgrowth factor activity / heparin bindingProcessesactivation of MAPKK activity / apoptotic process involved in morphogenesis / axon guidance / cartilage condensation / cell-cell signaling / chondroblast differentiation / cranial suture morphogenesis / embryonic hindlimb morphogenesis / epidermal growth factor receptor signaling pathway / Fc-epsilon receptor signaling pathway / fibroblast growth factor receptor signaling pathway / innate immune response / insulin receptor signaling pathway / MAPK cascade / mesenchymal cell proliferation / negative regulation of apoptotic process / neurotrophin TRK receptor signaling pathway / odontogenesis of dentin-containing tooth / phosphatidylinositol-mediated signaling / positive regulation of cell division / positive regulation of cell proliferation / positive regulation of ERK1 and ERK2 cascade / positive regulation of transcription from RNA polymerase II promoter / Ras protein signal transduction / regulation of endothelial cell chemotaxis to fibroblast growth factor / signal transduction / small GTPase mediated signal transduction / stem cell population maintenance / vascular endothelial growth factor receptor signaling pathwayComponentsextracellular region / intracellular
- General Function
- Heparin binding
- Specific Function
- Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal limb and cardiac valve development during embryogenesis.
- Pfam Domain Function
- FGF (PF00167)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0018940|Fibroblast growth factor 4 (FGF4) ATGTCGGGGCCCGGGACGGCCGCGGTAGCGCTGCTCCCGGCGGTCCTGCTGGCCTTGCTG GCGCCCTGGGCGGGCCGAGGGGGCGCCGCCGCACCCACTGCACCCAACGGCACGCTGGAG GCCGAGCTGGAGCGCCGCTGGGAGAGCCTGGTGGCGCTCTCGTTGGCGCGCCTGCCGGTG GCAGCGCAGCCCAAGGAGGCGGCCGTCCAGAGCGGCGCCGGCGACTACCTGCTGGGCATC AAGCGGCTGCGGCGGCTCTACTGCAACGTGGGCATCGGCTTCCACCTCCAGGCGCTCCCC GACGGCCGCATCGGCGGCGCGCACGCGGACACCCGCGACAGCCTGCTGGAGCTCTCGCCC GTGGAGCGGGGCGTGGTGAGCATCTTCGGCGTGGCCAGCCGGTTCTTCGTGGCCATGAGC AGCAAGGGCAAGCTCTATGGCTCGCCCTTCTTCACCGATGAGTGCACGTTCAAGGAGATT CTCCTTCCCAACAACTACAACGCCTACGAGTCCTACAAGTACCCCGGCATGTTCATCGCC CTGAGCAAGAATGGGAAGACCAAGAAGGGGAACCGAGTGTCGCCCACCATGAAGGTCACC CACTTCCTCCCCAGGCTGTGA
- Chromosome Location
- 11
- Locus
- 11q13.3
- External Identifiers
Resource Link UniProtKB ID P08620 UniProtKB Entry Name FGF4_HUMAN GenBank Protein ID 386788 GenBank Gene ID J02986 GenAtlas ID FGF4 HGNC ID HGNC:3682 - General References
- Mayshar Y, Rom E, Chumakov I, Kronman A, Yayon A, Benvenisty N: Fibroblast growth factor 4 and its novel splice isoform have opposing effects on the maintenance of human embryonic stem cell self-renewal. Stem Cells. 2008 Mar;26(3):767-74. doi: 10.1634/stemcells.2007-1037. Epub 2008 Jan 10. [Article]
- Yoshida T, Miyagawa K, Odagiri H, Sakamoto H, Little PF, Terada M, Sugimura T: Genomic sequence of hst, a transforming gene encoding a protein homologous to fibroblast growth factors and the int-2-encoded protein. Proc Natl Acad Sci U S A. 1987 Oct;84(20):7305-9. [Article]
- Taira M, Yoshida T, Miyagawa K, Sakamoto H, Terada M, Sugimura T: cDNA sequence of human transforming gene hst and identification of the coding sequence required for transforming activity. Proc Natl Acad Sci U S A. 1987 May;84(9):2980-4. [Article]
- Delli Bovi P, Curatola AM, Kern FG, Greco A, Ittmann M, Basilico C: An oncogene isolated by transfection of Kaposi's sarcoma DNA encodes a growth factor that is a member of the FGF family. Cell. 1987 Aug 28;50(5):729-37. [Article]
- Ornitz DM, Xu J, Colvin JS, McEwen DG, MacArthur CA, Coulier F, Gao G, Goldfarb M: Receptor specificity of the fibroblast growth factor family. J Biol Chem. 1996 Jun 21;271(25):15292-7. [Article]
- Turner N, Grose R: Fibroblast growth factor signalling: from development to cancer. Nat Rev Cancer. 2010 Feb;10(2):116-29. doi: 10.1038/nrc2780. [Article]
- Bellosta P, Iwahori A, Plotnikov AN, Eliseenkova AV, Basilico C, Mohammadi M: Identification of receptor and heparin binding sites in fibroblast growth factor 4 by structure-based mutagenesis. Mol Cell Biol. 2001 Sep;21(17):5946-57. [Article]