HTH-type transcriptional regulator EthR
Details
- Name
- HTH-type transcriptional regulator EthR
- Synonyms
- etaR
- Gene Name
- ethR
- Organism
- Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
- Amino acid sequence
>lcl|BSEQ0051187|HTH-type transcriptional regulator EthR MTTSAASQASLPRGRRTARPSGDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPT FYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPADTDRENMWRTGINVFFETFGSHKAV TRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNE RTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGENR
- Number of residues
- 216
- Molecular Weight
- 23756.465
- Theoretical pI
- Not Available
- GO Classification
- Functionstranscription factor activity, sequence-specific DNA binding / transcription regulatory region sequence-specific DNA bindingProcessesnegative regulation of transcription, DNA-templated / response to antibiotic / transcription, DNA-templatedComponentscytosol
- General Function
- Involved in the repression of the monooxygenase EthA which is responsible of the formation of the active metabolite of ethionamide (ETH).
- Specific Function
- Transcription factor activity, sequence-specific dna binding
- Pfam Domain Function
- TetR_N (PF00440)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0051188|HTH-type transcriptional regulator EthR (ethR) GTGACCACCTCCGCGGCCAGTCAGGCTTCGCTGCCTAGGGGCCGGCGCACCGCGCGGCCG TCCGGCGACGATCGTGAACTGGCGATCCTCGCCACCGCCGAGAACCTTCTCGAGGACCGT CCGCTGGCCGATATCTCGGTCGACGATCTGGCCAAGGGCGCCGGTATCTCGAGGCCGACG TTCTACTTCTATTTCCCATCCAAGGAAGCGGTGCTGCTGACCCTGCTGGACCGGGTGGTC AATCAAGCCGACATGGCCCTACAGACCCTTGCCGAGAATCCCGCCGACACCGACCGCGAG AACATGTGGCGCACCGGGATCAACGTGTTCTTCGAGACATTCGGGTCGCACAAGGCGGTA ACCCGAGCCGGTCAGGCCGCCAGGGCAACCAGTGTCGAAGTCGCCGAACTGTGGTCGACG TTTATGCAGAAGTGGATCGCCTACACGGCCGCCGTGATCGACGCCGAACGCGACCGAGGC GCGGCGCCGCGCACCCTGCCGGCCCATGAACTGGCCACAGCGCTCAACCTGATGAACGAG CGGACGCTGTTCGCGTCATTCGCCGGCGAACAGCCCTCGGTGCCGGAAGCCCGCGTGCTG GATACGCTGGTGCACATCTGGGTGACCAGCATTTACGGCGAGAACCGCTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P9WMC1 UniProtKB Entry Name ETHR_MYCTU - General References
- Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S, Barry CE 3rd, Tekaia F, Badcock K, Basham D, Brown D, Chillingworth T, Connor R, Davies R, Devlin K, Feltwell T, Gentles S, Hamlin N, Holroyd S, Hornsby T, Jagels K, Krogh A, McLean J, Moule S, Murphy L, Oliver K, Osborne J, Quail MA, Rajandream MA, Rogers J, Rutter S, Seeger K, Skelton J, Squares R, Squares S, Sulston JE, Taylor K, Whitehead S, Barrell BG: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Nature. 1998 Jun 11;393(6685):537-44. [Article]
- Baulard AR, Betts JC, Engohang-Ndong J, Quan S, McAdam RA, Brennan PJ, Locht C, Besra GS: Activation of the pro-drug ethionamide is regulated in mycobacteria. J Biol Chem. 2000 Sep 8;275(36):28326-31. [Article]
- DeBarber AE, Mdluli K, Bosman M, Bekker LG, Barry CE 3rd: Ethionamide activation and sensitivity in multidrug-resistant Mycobacterium tuberculosis. Proc Natl Acad Sci U S A. 2000 Aug 15;97(17):9677-82. [Article]
- Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A: Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3. [Article]
- Dover LG, Corsino PE, Daniels IR, Cocklin SL, Tatituri V, Besra GS, Futterer K: Crystal structure of the TetR/CamR family repressor Mycobacterium tuberculosis EthR implicated in ethionamide resistance. J Mol Biol. 2004 Jul 23;340(5):1095-105. [Article]
- Willand N, Dirie B, Carette X, Bifani P, Singhal A, Desroses M, Leroux F, Willery E, Mathys V, Deprez-Poulain R, Delcroix G, Frenois F, Aumercier M, Locht C, Villeret V, Deprez B, Baulard AR: Synthetic EthR inhibitors boost antituberculous activity of ethionamide. Nat Med. 2009 May;15(5):537-44. doi: 10.1038/nm.1950. Epub 2009 May 3. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB02425 Hexadecyl Octanoate experimental unknown Details DB08469 tert-butyl 4-(3-thiophen-2-yl-1,2,4-oxadiazol-5-yl)piperidine-1-carboxylate experimental unknown Details DB08470 3-(4-fluorophenyl)-5-phenyl-4H-1,2,4-triazole experimental unknown Details DB08471 1-(thiophen-2-ylacetyl)-4-(3-thiophen-2-yl-1,2,4-oxadiazol-5-yl)piperidine experimental unknown Details