Mast/stem cell growth factor receptor Kit

Details

Name
Mast/stem cell growth factor receptor Kit
Synonyms
  • 2.7.10.1
  • p145 c-kit
  • PBT
  • Piebald trait protein
  • Proto-oncogene c-Kit
  • SCFR
  • Tyrosine-protein kinase Kit
  • v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
Gene Name
KIT
Organism
Human
Amino acid sequence
>lcl|BSEQ0000903|Mast/stem cell growth factor receptor Kit
MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTD
PGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLV
DRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYH
RLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSS
SVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSAN
VTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWE
DYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDR
LVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDS
SAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIV
MILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAF
GKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGAC
TIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNE
YMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGM
AFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPES
IFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMY
DIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSV
GSTASSSQPLLVHDDV
Number of residues
976
Molecular Weight
109863.655
Theoretical pI
6.96
GO Classification
Functions
ATP binding / protein homodimerization activity / transmembrane receptor protein tyrosine kinase activity / protein tyrosine kinase activity / cytokine binding / metal ion binding / stem cell factor receptor activity / receptor signaling protein tyrosine kinase activity
Processes
positive regulation of cell migration / erythropoietin-mediated signaling pathway / dendritic cell cytokine production / signal transduction / cell chemotaxis / spermatid development / somatic stem cell division / stem cell population maintenance / pigmentation / activation of MAPKK activity / Fc receptor signaling pathway / cytokine-mediated signaling pathway / digestive tract development / positive regulation of Notch signaling pathway / positive regulation of MAPK cascade / mast cell chemotaxis / immature B cell differentiation / fibroblast growth factor receptor signaling pathway / embryonic hemopoiesis / hemopoiesis / germ cell migration / visual learning / megakaryocyte development / Kit signaling pathway / insulin receptor signaling pathway / positive regulation of tyrosine phosphorylation of Stat5 protein / positive regulation of JAK-STAT cascade / positive regulation of pseudopodium assembly / axon guidance / spermatogenesis / lamellipodium assembly / mast cell cytokine production / MAPK cascade / phosphatidylinositol-mediated signaling / positive regulation of tyrosine phosphorylation of Stat1 protein / epithelial cell proliferation / epidermal growth factor receptor signaling pathway / positive regulation of tyrosine phosphorylation of Stat3 protein / T cell differentiation / mast cell differentiation / neurotrophin TRK receptor signaling pathway / positive regulation of phosphatidylinositol 3-kinase activity / positive regulation of sequence-specific DNA binding transcription factor activity / mast cell proliferation / innate immune response / actin cytoskeleton reorganization / erythrocyte differentiation / Ras protein signal transduction / melanocyte adhesion / inflammatory response / positive regulation of phospholipase C activity / ectopic germ cell programmed cell death / peptidyl-tyrosine phosphorylation / detection of mechanical stimulus involved in sensory perception of sound / stem cell differentiation / somatic stem cell population maintenance / melanocyte differentiation / small GTPase mediated signal transduction / protein autophosphorylation / positive regulation of long-term neuronal synaptic plasticity / regulation of cell proliferation / mast cell degranulation / vascular endothelial growth factor receptor signaling pathway / melanocyte migration / activation of MAPK activity / glycosphingolipid metabolic process / ovarian follicle development / lymphoid progenitor cell differentiation / positive regulation of cell proliferation / myeloid progenitor cell differentiation / regulation of cell shape / male gonad development / Fc-epsilon receptor signaling pathway / negative regulation of programmed cell death / positive regulation of phosphatidylinositol 3-kinase signaling / regulation of developmental pigmentation / cellular response to thyroid hormone stimulus
Components
integral component of membrane / cytoplasmic side of plasma membrane / plasma membrane / extracellular space / mast cell granule / external side of plasma membrane / acrosomal vesicle / cell-cell junction
General Function
Transmembrane receptor protein tyrosine kinase activity
Specific Function
Tyrosine-protein kinase that acts as cell-surface receptor for the cytokine KITLG/SCF and plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. In response to KITLG/SCF binding, KIT can activate several signaling pathways. Phosphorylates PIK3R1, PLCG1, SH2B2/APS and CBL. Activates the AKT1 signaling pathway by phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase. Activated KIT also transmits signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Promotes activation of STAT family members STAT1, STAT3, STAT5A and STAT5B. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KIT signaling is modulated by protein phosphatases, and by rapid internalization and degradation of the receptor. Activated KIT promotes phosphorylation of the protein phosphatases PTPN6/SHP-1 and PTPRU, and of the transcription factors STAT1, STAT3, STAT5A and STAT5B. Promotes phosphorylation of PIK3R1, CBL, CRK (isoform Crk-II), LYN, MAPK1/ERK2 and/or MAPK3/ERK1, PLCG1, SRC and SHC1.
Pfam Domain Function
Transmembrane Regions
525-545
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0020461|Mast/stem cell growth factor receptor Kit (KIT)
ATGAGAGGCGCTCGCGGCGCCTGGGATTTTCTCTGCGTTCTGCTCCTACTGCTTCGCGTC
CAGACAGGCTCTTCTCAACCATCTGTGAGTCCAGGGGAACCGTCTCCACCATCCATCCAT
CCAGGAAAATCAGACTTAATAGTCCGCGTGGGCGACGAGATTAGGCTGTTATGCACTGAT
CCGGGCTTTGTCAAATGGACTTTTGAGATCCTGGATGAAACGAATGAGAATAAGCAGAAT
GAATGGATCACGGAAAAGGCAGAAGCCACCAACACCGGCAAATACACGTGCACCAACAAA
CACGGCTTAAGCAATTCCATTTATGTGTTTGTTAGAGATCCTGCCAAGCTTTTCCTTGTT
GACCGCTCCTTGTATGGGAAAGAAGACAACGACACGCTGGTCCGCTGTCCTCTCACAGAC
CCAGAAGTGACCAATTATTCCCTCAAGGGGTGCCAGGGGAAGCCTCTTCCCAAGGACTTG
AGGTTTATTCCTGACCCCAAGGCGGGCATCATGATCAAAAGTGTGAAACGCGCCTACCAT
CGGCTCTGTCTGCATTGTTCTGTGGACCAGGAGGGCAAGTCAGTGCTGTCGGAAAAATTC
ATCCTGAAAGTGAGGCCAGCCTTCAAAGCTGTGCCTGTTGTGTCTGTGTCCAAAGCAAGC
TATCTTCTTAGGGAAGGGGAAGAATTCACAGTGACGTGCACAATAAAAGATGTGTCTAGT
TCTGTGTACTCAACGTGGAAAAGAGAAAACAGTCAGACTAAACTACAGGAGAAATATAAT
AGCTGGCATCACGGTGACTTCAATTATGAACGTCAGGCAACGTTGACTATCAGTTCAGCG
AGAGTTAATGATTCTGGAGTGTTCATGTGTTATGCCAATAATACTTTTGGATCAGCAAAT
GTCACAACAACCTTGGAAGTAGTAGATAAAGGATTCATTAATATCTTCCCCATGATAAAC
ACTACAGTATTTGTAAACGATGGAGAAAATGTAGATTTGATTGTTGAATATGAAGCATTC
CCCAAACCTGAACACCAGCAGTGGATCTATATGAACAGAACCTTCACTGATAAATGGGAA
GATTATCCCAAGTCTGAGAATGAAAGTAATATCAGATACGTAAGTGAACTTCATCTAACG
AGATTAAAAGGCACCGAAGGAGGCACTTACACATTCCTAGTGTCCAATTCTGACGTCAAT
GCTGCCATAGCATTTAATGTTTATGTGAATACAAAACCAGAAATCCTGACTTACGACAGG
CTCGTGAATGGCATGCTCCAATGTGTGGCAGCAGGATTCCCAGAGCCCACAATAGATTGG
TATTTTTGTCCAGGAACTGAGCAGAGATGCTCTGCTTCTGTACTGCCAGTGGATGTGCAG
ACACTAAACTCATCTGGGCCACCGTTTGGAAAGCTAGTGGTTCAGAGTTCTATAGATTCT
AGTGCATTCAAGCACAATGGCACGGTTGAATGTAAGGCTTACAACGATGTGGGCAAGACT
TCTGCCTATTTTAACTTTGCATTTAAAGGTAACAACAAAGAGCAAATCCATCCCCACACC
CTGTTCACTCCTTTGCTGATTGGTTTCGTAATCGTAGCTGGCATGATGTGCATTATTGTG
ATGATTCTGACCTACAAATATTTACAGAAACCCATGTATGAAGTACAGTGGAAGGTTGTT
GAGGAGATAAATGGAAACAATTATGTTTACATAGACCCAACACAACTTCCTTATGATCAC
AAATGGGAGTTTCCCAGAAACAGGCTGAGTTTTGGGAAAACCCTGGGTGCTGGAGCTTTC
GGGAAGGTTGTTGAGGCAACTGCTTATGGCTTAATTAAGTCAGATGCGGCCATGACTGTC
GCTGTAAAGATGCTCAAGCCGAGTGCCCATTTGACAGAACGGGAAGCCCTCATGTCTGAA
CTCAAAGTCCTGAGTTACCTTGGTAATCACATGAATATTGTGAATCTACTTGGAGCCTGC
ACCATTGGAGGGCCCACCCTGGTCATTACAGAATATTGTTGCTATGGTGATCTTTTGAAT
TTTTTGAGAAGAAAACGTGATTCATTTATTTGTTCAAAGCAGGAAGATCATGCAGAAGCT
GCACTTTATAAGAATCTTCTGCATTCAAAGGAGTCTTCCTGCAGCGATAGTACTAATGAG
TACATGGACATGAAACCTGGAGTTTCTTATGTTGTCCCAACCAAGGCCGACAAAAGGAGA
TCTGTGAGAATAGGCTCATACATAGAAAGAGATGTGACTCCCGCCATCATGGAGGATGAC
GAGTTGGCCCTAGACTTAGAAGACTTGCTGAGCTTTTCTTACCAGGTGGCAAAGGGCATG
GCTTTCCTCGCCTCCAAGAATTGTATTCACAGAGACTTGGCAGCCAGAAATATCCTCCTT
ACTCATGGTCGGATCACAAAGATTTGTGATTTTGGTCTAGCCAGAGACATCAAGAATGAT
TCTAATTATGTGGTTAAAGGAAACGCTCGACTACCTGTGAAGTGGATGGCACCTGAAAGC
ATTTTCAACTGTGTATACACGTTTGAAAGTGACGTCTGGTCCTATGGGATTTTTCTTTGG
GAGCTGTTCTCTTTAGGAAGCAGCCCCTATCCTGGAATGCCGGTCGATTCTAAGTTCTAC
AAGATGATCAAGGAAGGCTTCCGGATGCTCAGCCCTGAACACGCACCTGCTGAAATGTAT
GACATAATGAAGACTTGCTGGGATGCAGATCCCCTAAAAAGACCAACATTCAAGCAAATT
GTTCAGCTAATTGAGAAGCAGATTTCAGAGAGCACCAATCATATTTACTCCAACTTAGCA
AACTGCAGCCCCAACCGACAGAAGCCCGTGGTAGACCATTCTGTGCGGATCAATTCTGTC
GGCAGCACCGCTTCCTCCTCCCAGCCTCTGCTTGTGCACGACGATGTCTGA
Chromosome Location
4
Locus
4q11-q12
External Identifiers
ResourceLink
UniProtKB IDP10721
UniProtKB Entry NameKIT_HUMAN
GenBank Protein ID34085
GenBank Gene IDX06182
GenAtlas IDKIT
HGNC IDHGNC:6342
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00398Sorafenibapproved, investigationalyesantagonistDetails
DB00619ImatinibapprovedyesantagonistmultitargetDetails
DB01254Dasatinibapproved, investigationalunknownantagonistDetails
DB01268Sunitinibapproved, investigationalyesinhibitorDetails
DB01962PhosphonotyrosineexperimentalunknownDetails
DB04868Nilotinibapproved, investigationalunknownantagonistDetails
DB12742AmuvatinibinvestigationalunknownDetails
DB05146XL820investigationalunknownDetails
DB06080ABT-869investigationalunknownDetails
DB05913OSI-930investigationalunknownDetails
DB06589PazopanibapprovedyesinhibitorDetails
DB06595Midostaurinapproved, investigationalunknownantagonistinhibitorDetails
DB08896RegorafenibapprovedyesinhibitorDetails
DB08901Ponatinibapproved, investigationalunknowninhibitorDetails
DB09078Lenvatinibapproved, investigationalyesinhibitorDetails
DB09103Ancestimapproved, investigational, withdrawnyesagonistDetails