Ancestim

Identification

Name
Ancestim
Accession Number
DB09103
Type
Biotech
Groups
Approved, Investigational, Withdrawn
Biologic Classification
Protein Based Therapies
Haematopoietic growth factors
Description

Ancestim is a non-glycosylated recombinant methionyl human stem cell factor. It is a 166 amino acid protein produced by E. coli with an amino acid sequence that is identical to the natural sequence predicted from human DNA sequence analysis, except for the addition of an N-terminal methionine.[5] Ancestim was developed by Amgen and sold to Biovitrium, now Swedish Orphan Biovitrum, in December 2008. It was submitted to the FDA under the status of recommendation for approval with a 10 to 1 votes.[2] It was also approved by Health Canada in 1999 but it is currently under the status of canceled post-market.[4]

Protein structure
Db09103
Protein chemical formula
C1662H2650N422O512S18
Protein average weight
18540.0 Da (non-glycosylated)
Sequences
>>Sequence Stem Cell Factor<<<<
MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDL
LDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIF
NRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
Download FASTA Format
Synonyms
Not Available
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing End
StemgenAncestim (1875 mcg) + Water (5 ml)Kit; Powder, for solutionSubcutaneousBiovitrum Ab (Publ)1999-09-202012-12-31Canada
StemgenAncestim (2500 mcg) + Water (5 ml)Kit; Powder, for solutionSubcutaneousBiovitrum Ab (Publ)Not applicableNot applicableCanada
Categories
UNII
PYB4Q6JG41
CAS number
163545-26-4

Pharmacology

Indication

Ancestim, in combination with filgrastim, is indicated for the setting of autologous peripheral blood progenitor cell transplantation in patients at risk of poor peripheral blood progenitor cell mobilisation.[7] The use of ancestim with filgrastim will generate a sustained increase in the number of peripheral blood progenitor cells capable of engraftment. It is used for mobilization of progenitor cells from the bone marrow to the peripheral blood with or withouth mobilizing chemotherapy. The harvested progenitor cells can be used for transplant following myelosuppressive or myeloablative therapies.[6]

Structured Indications
Not Available
Pharmacodynamics

Ancestim action on hemotopeitic progenitor cells stimulates its proliferation, differentiation, commitment and functional activation. This stimulation results in an increase on circulating peripheral blood progenitor cells like CD34, granulocyte macrophage colony-forming units and erythroid burst-forming units.[6]

Mechanism of action

Ancestim alone is unable to increase peripheral blood progenitor cells so it has to be administered with filgastrim, a granulocyte colony-stimulating factor.[3] Ancestrim will bind to the c-KIT expressed in hemocytoblasts, myeloid progenitors, megakaryocytes, immature mast cells, myeloblasts and lymphoid progenitors. Ancestim binding will cause receptor homodimerization and autophosphorylation at tyrosine residues. The activation of this receptor leads to the activation of a signaling cascade that contains the RAS/ERK, PI3-Kinase, Src kinase and JAK/STAT pathways which will later stimulate proliferation, differentiation and activation of the cell lines.[1]

TargetActionsOrganism
AMast/stem cell growth factor receptor Kit
agonist
Human
Absorption

The pharmacokinetics of ancestim has a dose-linear profile. After subcutaneous administration, ancestim has an absorption half-life of 35-41 hours following a mean lag of 2 hours. When a dose of 5-25 mcg/kg is administered, the peak concentration of 3.6-13.7 ng/ml is reached after 15-24 hours. In preclinical studies, the bioavailability of ancestim was reported to be greater than 60%. After multiple dosing, the steady state was reached after 4-5 days from the beginning of the treatment.[6]

Volume of distribution

Preclinical reports demonstrate that after intravenous administration of ancestim, the distribution profile is primarily in plasma and kidneys with a subsequent and rapid loss from all tissues.[6]

Protein binding
Not Available
Metabolism

Administration of ancestim in preclinical trials have proven that from the excreted dose all of it is formed by degraded ancestim into lower molecular weigth products.[6]

Route of elimination

In preclinical studies, it was shown that 90% of the administered dose is excreted in the urine.[6]

Half life

In clinical trials, the reported half life for ancestim was between 2-5 hours.[6]

Clearance

The apparent clearance reported for ancestim is approximately 35-40 ml/h/kg.[6]

Toxicity

Ancestim was not genotoxic for gene mutation or chromosomal damage and it did not have any effect in fertility.[6]

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
10-hydroxycamptothecinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with 10-hydroxycamptothecin.Investigational
2-(4-Chlorophenyl)-5-QuinoxalinecarboxamideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with 2-(4-Chlorophenyl)-5-Quinoxalinecarboxamide.Experimental
2-chloroethyl-3-sarcosinamide-1-nitrosoureaThe risk or severity of cytotoxicity can be increased when Ancestim is combined with 2-chloroethyl-3-sarcosinamide-1-nitrosourea.Investigational
2-MethoxyestradiolThe risk or severity of cytotoxicity can be increased when Ancestim is combined with 2-Methoxyestradiol.Investigational
3-MethoxybenzamideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with 3-Methoxybenzamide.Experimental
3,3'-diindolylmethaneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with 3,3'-diindolylmethane.Investigational
3,4-Dihydroxybenzoic AcidThe risk or severity of cytotoxicity can be increased when Ancestim is combined with 3,4-Dihydroxybenzoic Acid.Experimental
6-O-benzylguanineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with 6-O-benzylguanine.Investigational
7-HydroxystaurosporineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with 7-Hydroxystaurosporine.Experimental, Investigational
8-azaguanineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with 8-azaguanine.Experimental
9-aminocamptothecinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with 9-aminocamptothecin.Investigational
AbirateroneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Abiraterone.Approved
AclarubicinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Aclarubicin.Investigational
Acridine CarboxamideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Acridine Carboxamide.Investigational
ActeosideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Acteoside.Investigational
AfatinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Afatinib.Approved
AfimoxifeneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Afimoxifene.Investigational
AfliberceptThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Aflibercept.Approved
AlanosineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Alanosine.Investigational
AlatrofloxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Alatrofloxacin.Withdrawn
AlbendazoleThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Albendazole.Approved, Vet Approved
AldesleukinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Aldesleukin.Approved
AlectinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Alectinib.Approved
AlemtuzumabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Alemtuzumab.Approved, Investigational
AlitretinoinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Alitretinoin.Approved, Investigational
AltretamineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Altretamine.Approved
AlvocidibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Alvocidib.Experimental, Investigational
AminoglutethimideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Aminoglutethimide.Approved, Investigational
Aminolevulinic acidThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Aminolevulinic acid.Approved
AmonafideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Amonafide.Investigational
AmrubicinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Amrubicin.Approved, Investigational
AmsacrineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Amsacrine.Approved
AnagrelideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Anagrelide.Approved
AnastrozoleThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Anastrozole.Approved, Investigational
AnecortaveThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Anecortave.Investigational
AnnamycinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Annamycin.Investigational
AP 12009The risk or severity of cytotoxicity can be increased when Ancestim is combined with AP 12009.Investigational
ApaziquoneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Apaziquone.Investigational
Arotinoid acidThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Arotinoid acid.Experimental
Arsanilic acidThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Arsanilic acid.Experimental, Vet Approved
Arsenic trioxideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Arsenic trioxide.Approved, Investigational
AsparaginaseThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Asparaginase.Approved
AtezolizumabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Atezolizumab.Approved
AvelumabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Avelumab.Approved
AxitinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Axitinib.Approved, Investigational
AzacitidineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Azacitidine.Approved, Investigational
AzathioprineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Azathioprine.Approved
Azelaic AcidThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Azelaic Acid.Approved
BatimastatThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Batimastat.Experimental
BelinostatThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Belinostat.Approved, Investigational
BelotecanThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Belotecan.Investigational
BendamustineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Bendamustine.Approved, Investigational
BesifloxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Besifloxacin.Approved
BevacizumabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Bevacizumab.Approved, Investigational
BexaroteneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Bexarotene.Approved, Investigational
BicalutamideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Bicalutamide.Approved
BinetrakinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Binetrakin.Investigational
BizelesinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Bizelesin.Investigational
BleomycinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Bleomycin.Approved
BlinatumomabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Blinatumomab.Approved
BortezomibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Bortezomib.Approved, Investigational
BosutinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Bosutinib.Approved
Brentuximab vedotinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Brentuximab vedotin.Approved
BroxuridineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Broxuridine.Investigational
Bryostatin 1The risk or severity of cytotoxicity can be increased when Ancestim is combined with Bryostatin 1.Investigational
BuserelinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Buserelin.Approved
BusulfanThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Busulfan.Approved, Investigational
Buthionine SulfoximineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Buthionine Sulfoximine.Investigational
CabazitaxelThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Cabazitaxel.Approved
CabergolineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Cabergoline.Approved
CabozantinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Cabozantinib.Approved
CalcipotriolThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Calcipotriol.Approved
CamptothecinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Camptothecin.Experimental
CanertinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Canertinib.Investigational
CapecitabineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Capecitabine.Approved, Investigational
CarboplatinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Carboplatin.Approved
CarboquoneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Carboquone.Experimental
CarboxyamidotriazoleThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Carboxyamidotriazole.Investigational
CarfilzomibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Carfilzomib.Approved
CarmofurThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Carmofur.Withdrawn
CarmustineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Carmustine.Approved
CatumaxomabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Catumaxomab.Approved, Investigational, Withdrawn
CediranibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Cediranib.Investigational
CeritinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Ceritinib.Approved
CetuximabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Cetuximab.Approved
ChlorambucilThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Chlorambucil.Approved
ChlorotrianiseneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Chlorotrianisene.Investigational, Withdrawn
CholesterolThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Cholesterol.Experimental, Investigational
CinoxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Cinoxacin.Approved, Investigational, Withdrawn
CiprofloxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Ciprofloxacin.Approved, Investigational
CisplatinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Cisplatin.Approved
CladribineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Cladribine.Approved, Investigational
ClofarabineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Clofarabine.Approved, Investigational
CobimetinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Cobimetinib.Approved
ColchicineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Colchicine.Approved
CombretastatinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Combretastatin.Investigational
CordycepinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Cordycepin.Investigational
Coumermycin A1The risk or severity of cytotoxicity can be increased when Ancestim is combined with Coumermycin A1.Experimental
CrenolanibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Crenolanib.Investigational
CrizotinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Crizotinib.Approved
CurcuminThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Curcumin.Investigational
CyclophosphamideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Cyclophosphamide.Approved, Investigational
Cyproterone acetateThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Cyproterone acetate.Approved, Investigational
CytarabineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Cytarabine.Approved, Investigational
DabrafenibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Dabrafenib.Approved
DacarbazineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Dacarbazine.Approved, Investigational
DactinomycinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Dactinomycin.Approved
DaratumumabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Daratumumab.Approved
DasatinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Dasatinib.Approved, Investigational
DaunorubicinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Daunorubicin.Approved
DecitabineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Decitabine.Approved, Investigational
DegarelixThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Degarelix.Approved
DemecolcineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Demecolcine.Experimental
Denileukin diftitoxThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Denileukin diftitox.Approved, Investigational
DeoxyspergualinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Deoxyspergualin.Investigational
DexamethasoneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Dexamethasone.Approved, Investigational, Vet Approved
DexrazoxaneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Dexrazoxane.Approved, Withdrawn
DianhydrogalactitolThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Dianhydrogalactitol.Investigational
DidoxThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Didox.Investigational
DienogestThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Dienogest.Approved
DiethylnorspermineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Diethylnorspermine.Investigational
DiethylstilbestrolThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Diethylstilbestrol.Approved, Investigational
DinutuximabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Dinutuximab.Approved
DocetaxelThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Docetaxel.Approved, Investigational
Dolastatin 10The risk or severity of cytotoxicity can be increased when Ancestim is combined with Dolastatin 10.Investigational
DoxifluridineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Doxifluridine.Investigational
DoxorubicinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Doxorubicin.Approved, Investigational
DuligotuzumabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Duligotuzumab.Investigational
DurvalumabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Durvalumab.Approved
EcabetThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Ecabet.Approved, Investigational
EdrecolomabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Edrecolomab.Experimental, Investigational
EfaproxiralThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Efaproxiral.Investigational
EfatutazoneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Efatutazone.Investigational
EflornithineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Eflornithine.Approved, Withdrawn
EG009The risk or severity of cytotoxicity can be increased when Ancestim is combined with EG009.Investigational
ElotuzumabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Elotuzumab.Approved
ElsamitrucinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Elsamitrucin.Investigational
EndostatinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Endostatin.Investigational
EnoxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Enoxacin.Approved, Investigational
EnrofloxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Enrofloxacin.Vet Approved
EntinostatThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Entinostat.Investigational
EnzalutamideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Enzalutamide.Approved
Epigallocatechin GallateThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Epigallocatechin Gallate.Investigational
EpirubicinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Epirubicin.Approved
EpofolateThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Epofolate.Investigational
EribulinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Eribulin.Approved, Investigational
ErlotinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Erlotinib.Approved, Investigational
EstramustineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Estramustine.Approved
EtanidazoleThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Etanidazole.Investigational
Ethiodized oilThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Ethiodized oil.Approved
Ethyl carbamateThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Ethyl carbamate.Withdrawn
EtoglucidThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Etoglucid.Experimental
EtoposideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Etoposide.Approved
EverolimusThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Everolimus.Approved
ExatecanThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Exatecan.Investigational
ExemestaneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Exemestane.Approved, Investigational
ExisulindThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Exisulind.Investigational
FenretinideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Fenretinide.Investigational
FiacitabineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Fiacitabine.Investigational
FleroxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Fleroxacin.Approved
FloxuridineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Floxuridine.Approved
FludarabineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Fludarabine.Approved
FlumequineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Flumequine.Withdrawn
FluorouracilThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Fluorouracil.Approved
FlutamideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Flutamide.Approved
FormestaneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Formestane.Approved, Investigational, Withdrawn
FormycinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Formycin.Experimental
FosbretabulinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Fosbretabulin.Investigational
FotemustineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Fotemustine.Experimental, Investigational
FulvestrantThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Fulvestrant.Approved, Investigational
FumagillinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Fumagillin.Experimental
Gallium nitrateThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Gallium nitrate.Approved, Investigational
GarenoxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Garenoxacin.Investigational
GatifloxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Gatifloxacin.Approved, Investigational
GefitinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Gefitinib.Approved, Investigational
GeldanamycinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Geldanamycin.Experimental, Investigational
GemcitabineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Gemcitabine.Approved
GemifloxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Gemifloxacin.Approved, Investigational
Gemtuzumab ozogamicinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Gemtuzumab ozogamicin.Approved
GenisteinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Genistein.Investigational
Ginsenoside CThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Ginsenoside C.Nutraceutical
GoserelinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Goserelin.Approved
GrepafloxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Grepafloxacin.Investigational, Withdrawn
GS 0573The risk or severity of cytotoxicity can be increased when Ancestim is combined with GS 0573.Investigational
GusperimusThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Gusperimus.Investigational
HadacidinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Hadacidin.Experimental
HalofuginoneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Halofuginone.Investigational, Vet Approved
HexestrolThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Hexestrol.Withdrawn
Hydroxyprogesterone caproateThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Hydroxyprogesterone caproate.Approved
HydroxyureaThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Hydroxyurea.Approved
HypericinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Hypericin.Investigational
IbrutinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Ibrutinib.Approved
IdarubicinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Idarubicin.Approved
IdelalisibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Idelalisib.Approved
IfosfamideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Ifosfamide.Approved
ImatinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Imatinib.Approved
ImiquimodThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Imiquimod.Approved, Investigational
IndirubinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Indirubin.Investigational
Indole-3-carbinolThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Indole-3-carbinol.Investigational
InfigratinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Infigratinib.Investigational
IniparibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Iniparib.Investigational
Interferon Alfa-2b, RecombinantThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Interferon Alfa-2b, Recombinant.Approved
Interferon beta-1aThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Interferon beta-1a.Approved, Investigational
IobenguaneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Iobenguane.Approved, Investigational
IpilimumabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Ipilimumab.Approved
IrinotecanThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Irinotecan.Approved, Investigational
IrofulvenThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Irofulven.Investigational
IrsogladineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Irsogladine.Investigational
IsosorbideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Isosorbide.Approved, Investigational
IxabepiloneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Ixabepilone.Approved, Investigational
IxazomibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Ixazomib.Approved
KOS-1584The risk or severity of cytotoxicity can be increased when Ancestim is combined with KOS-1584.Investigational
KRN-7000The risk or severity of cytotoxicity can be increased when Ancestim is combined with KRN-7000.Investigational
LanreotideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Lanreotide.Approved
LapatinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Lapatinib.Approved, Investigational
LCL-161The risk or severity of cytotoxicity can be increased when Ancestim is combined with LCL-161.Investigational
LeflunomideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Leflunomide.Approved, Investigational
LenalidomideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Lenalidomide.Approved
LentinanThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Lentinan.Experimental, Investigational
LenvatinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Lenvatinib.Approved
LetrozoleThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Letrozole.Approved, Investigational
LeuprolideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Leuprolide.Approved, Investigational
LevofloxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Levofloxacin.Approved, Investigational
LiarozoleThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Liarozole.Investigational
LomefloxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Lomefloxacin.Approved, Investigational
LometrexolThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Lometrexol.Investigational
LomustineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Lomustine.Approved
LonidamineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Lonidamine.Investigational
LurtotecanThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Lurtotecan.Investigational
LycopeneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Lycopene.Approved
MafosfamideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Mafosfamide.Investigational
MannosulfanThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Mannosulfan.Experimental
MasitinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Masitinib.Investigational, Vet Approved
MasoprocolThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Masoprocol.Approved, Investigational
MaxacalcitolThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Maxacalcitol.Approved, Investigational
MebendazoleThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Mebendazole.Approved, Vet Approved
MechlorethamineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Mechlorethamine.Approved
MedrogestoneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Medrogestone.Approved
Medroxyprogesterone acetateThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Medroxyprogesterone acetate.Approved, Investigational
Megestrol acetateThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Megestrol acetate.Approved, Vet Approved
MelphalanThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Melphalan.Approved
MequinolThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Mequinol.Approved
MercaptopurineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Mercaptopurine.Approved
MerestinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Merestinib.Investigational
MethotrexateThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Methotrexate.Approved
Methyl aminolevulinateThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Methyl aminolevulinate.Approved
MethylprednisoloneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Methylprednisolone.Approved, Vet Approved
MethylselenocysteineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Methylselenocysteine.Investigational
MethyltestosteroneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Methyltestosterone.Approved
MetoprineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Metoprine.Experimental
MidostaurinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Midostaurin.Approved
MiltefosineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Miltefosine.Approved
MisonidazoleThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Misonidazole.Investigational
MitobronitolThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Mitobronitol.Experimental
MitoguazoneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Mitoguazone.Investigational
MitolactolThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Mitolactol.Investigational
MitomycinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Mitomycin.Approved
MitotaneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Mitotane.Approved
MitoxantroneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Mitoxantrone.Approved, Investigational
MizoribineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Mizoribine.Investigational
MLN576The risk or severity of cytotoxicity can be increased when Ancestim is combined with MLN576.Investigational
MolgramostimThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Molgramostim.Investigational
motexafin gadoliniumThe risk or severity of cytotoxicity can be increased when Ancestim is combined with motexafin gadolinium.Investigational
MoxifloxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Moxifloxacin.Approved, Investigational
Mycophenolate mofetilThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Mycophenolate mofetil.Approved, Investigational
Mycophenolic acidThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Mycophenolic acid.Approved
NadifloxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Nadifloxacin.Investigational
Nalidixic AcidThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Nalidixic Acid.Approved, Investigational
NamitecanThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Namitecan.Investigational
NavitoclaxThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Navitoclax.Investigational
NebularineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Nebularine.Experimental
NecitumumabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Necitumumab.Approved
NedaplatinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Nedaplatin.Approved, Investigational
NelarabineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Nelarabine.Approved, Investigational
NiguldipineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Niguldipine.Experimental
NilotinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Nilotinib.Approved, Investigational
NilutamideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Nilutamide.Approved
NimustineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Nimustine.Investigational
NintedanibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Nintedanib.Approved
NiraparibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Niraparib.Approved, Investigational
NivolumabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Nivolumab.Approved
nocodazoleThe risk or severity of cytotoxicity can be increased when Ancestim is combined with nocodazole.Experimental
NolatrexedThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Nolatrexed.Investigational
NorfloxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Norfloxacin.Approved
ObinutuzumabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Obinutuzumab.Approved
OblimersenThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Oblimersen.Experimental, Investigational
OBP-801The risk or severity of cytotoxicity can be increased when Ancestim is combined with OBP-801.Investigational
OctreotideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Octreotide.Approved, Investigational
OfatumumabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Ofatumumab.Approved
OfloxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Ofloxacin.Approved
OglufanideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Oglufanide.Investigational
OlaparibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Olaparib.Approved
OlaratumabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Olaratumab.Approved
OltiprazThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Oltipraz.Investigational
Omacetaxine mepesuccinateThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Omacetaxine mepesuccinate.Approved
OnapristoneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Onapristone.Investigational
OprelvekinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Oprelvekin.Approved, Investigational
OsimertinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Osimertinib.Approved
OxaliplatinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Oxaliplatin.Approved, Investigational
Oxolinic acidThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Oxolinic acid.Experimental
PaclitaxelThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Paclitaxel.Approved, Vet Approved
Paclitaxel poliglumexThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Paclitaxel poliglumex.Experimental, Investigational
PalbociclibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Palbociclib.Approved
PalifosfamideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Palifosfamide.Investigational
PamidronateThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Pamidronate.Approved
PanitumumabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Panitumumab.Approved, Investigational
PanobinostatThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Panobinostat.Approved, Investigational
PatupiloneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Patupilone.Experimental, Investigational
PazopanibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Pazopanib.Approved
PazufloxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Pazufloxacin.Investigational
PefloxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Pefloxacin.Approved
PegaspargaseThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Pegaspargase.Approved, Investigational
PembrolizumabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Pembrolizumab.Approved
PemetrexedThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Pemetrexed.Approved, Investigational
PenclomedineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Penclomedine.Investigational
PentostatinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Pentostatin.Approved, Investigational
PertuzumabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Pertuzumab.Approved
Phenethyl IsothiocyanateThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Phenethyl Isothiocyanate.Investigational
Phenylacetic acidThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Phenylacetic acid.Approved
Phenylbutyric acidThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Phenylbutyric acid.Approved, Investigational
PinometostatThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Pinometostat.Investigational
PipobromanThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Pipobroman.Approved
PirarubicinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Pirarubicin.Investigational
PirfenidoneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Pirfenidone.Approved, Investigational
PirlindoleThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Pirlindole.Approved
PixantroneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Pixantrone.Approved, Investigational
PlevitrexedThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Plevitrexed.Investigational
PlicamycinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Plicamycin.Approved, Investigational, Withdrawn
PodofiloxThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Podofilox.Approved
PodophyllinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Podophyllin.Approved
PomalidomideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Pomalidomide.Approved
PonatinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Ponatinib.Approved
Porfimer sodiumThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Porfimer sodium.Approved, Investigational
PorfiromycinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Porfiromycin.Investigational
PralatrexateThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Pralatrexate.Approved
PrednimustineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Prednimustine.Investigational
PrednisoloneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Prednisolone.Approved, Vet Approved
PrednisoneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Prednisone.Approved, Vet Approved
ProcarbazineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Procarbazine.Approved
PrulifloxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Prulifloxacin.Investigational
PuromycinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Puromycin.Experimental
PyrazoloacridineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Pyrazoloacridine.Investigational
QuinacrineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Quinacrine.Approved, Investigational
RabusertibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Rabusertib.Investigational
Radium Ra 223 DichlorideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Radium Ra 223 Dichloride.Approved, Investigational
RaltitrexedThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Raltitrexed.Approved, Investigational
RamucirumabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Ramucirumab.Approved, Investigational
RanibizumabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Ranibizumab.Approved
RanimustineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Ranimustine.Experimental
RanpirnaseThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Ranpirnase.Investigational
RegorafenibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Regorafenib.Approved
ResveratrolThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Resveratrol.Approved, Experimental, Investigational
Rhodamine 6GThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Rhodamine 6G.Experimental
RidaforolimusThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Ridaforolimus.Investigational
RituximabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Rituximab.Approved
RomidepsinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Romidepsin.Approved, Investigational
RoquinimexThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Roquinimex.Investigational
RubitecanThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Rubitecan.Investigational
RucaparibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Rucaparib.Approved, Investigational
RufloxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Rufloxacin.Experimental
RuxolitinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Ruxolitinib.Approved
SalirasibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Salirasib.Investigational
SaracatinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Saracatinib.Investigational
SatraplatinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Satraplatin.Investigational
SeliciclibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Seliciclib.Investigational
SemaxanibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Semaxanib.Investigational
SemustineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Semustine.Experimental, Investigational
SeocalcitolThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Seocalcitol.Experimental, Investigational
SiltuximabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Siltuximab.Approved
SirolimusThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Sirolimus.Approved, Investigational
SitafloxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Sitafloxacin.Experimental, Investigational
SizofiranThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Sizofiran.Investigational
SoblidotinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Soblidotin.Investigational
SonidegibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Sonidegib.Approved, Investigational
SorafenibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Sorafenib.Approved, Investigational
SparfloxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Sparfloxacin.Approved, Investigational
Sparfosic acidThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Sparfosic acid.Experimental
SparsomycinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Sparsomycin.Experimental
SqualamineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Squalamine.Investigational
SRT501The risk or severity of cytotoxicity can be increased when Ancestim is combined with SRT501.Investigational
StreptozocinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Streptozocin.Approved
SulforaphaneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Sulforaphane.Investigational
SulindacThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Sulindac.Approved
SunitinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Sunitinib.Approved, Investigational
SuraminThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Suramin.Approved, Investigational
TalaporfinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Talaporfin.Investigational
TalazoparibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Talazoparib.Investigational
TamoxifenThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Tamoxifen.Approved
TaselisibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Taselisib.Investigational
TaurolidineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Taurolidine.Investigational
TegafurThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Tegafur.Approved
TemafloxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Temafloxacin.Withdrawn
TemoporfinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Temoporfin.Approved, Investigational
TemozolomideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Temozolomide.Approved, Investigational
TemsirolimusThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Temsirolimus.Approved
TeniposideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Teniposide.Approved
TestolactoneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Testolactone.Approved, Investigational
TezacitabineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Tezacitabine.Investigational
ThalidomideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Thalidomide.Approved, Investigational, Withdrawn
ThiotepaThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Thiotepa.Approved
ThymalfasinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Thymalfasin.Approved, Investigational
TiazofurineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Tiazofurine.Experimental
TiboloneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Tibolone.Approved, Investigational
TioguanineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Tioguanine.Approved
Tiomolibdate ionThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Tiomolibdate ion.Investigational
TipifarnibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Tipifarnib.Investigational
TirapazamineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Tirapazamine.Investigational
TivozanibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Tivozanib.Investigational
TopotecanThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Topotecan.Approved, Investigational
ToremifeneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Toremifene.Approved, Investigational
TositumomabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Tositumomab.Approved, Investigational
ToyocamycinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Toyocamycin.Experimental
TrabectedinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Trabectedin.Approved, Investigational
TrametinibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Trametinib.Approved
TranscrocetinateThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Transcrocetinate.Investigational
TrastuzumabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Trastuzumab.Approved, Investigational
Trastuzumab emtansineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Trastuzumab emtansine.Approved
TrebananibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Trebananib.Investigational
TremelimumabThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Tremelimumab.Investigational
TreosulfanThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Treosulfan.Investigational
TretazicarThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Tretazicar.Investigational
TretinoinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Tretinoin.Approved, Investigational, Nutraceutical
TriaziquoneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Triaziquone.Experimental
TrifluridineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Trifluridine.Approved
TrilostaneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Trilostane.Approved, Investigational, Vet Approved, Withdrawn
TrimetrexateThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Trimetrexate.Approved, Investigational
TriptolideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Triptolide.Investigational
TriptorelinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Triptorelin.Approved, Vet Approved
TrofosfamideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Trofosfamide.Investigational
TrovafloxacinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Trovafloxacin.Approved, Investigational, Withdrawn
TroxacitabineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Troxacitabine.Investigational
TubercidinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Tubercidin.Experimental
UbenimexThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Ubenimex.Experimental, Investigational
Uracil mustardThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Uracil mustard.Approved
VadimezanThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Vadimezan.Investigational
ValrubicinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Valrubicin.Approved
VandetanibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Vandetanib.Approved
VapreotideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Vapreotide.Approved, Investigational
VeliparibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Veliparib.Investigational
VemurafenibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Vemurafenib.Approved
VenetoclaxThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Venetoclax.Approved
VerteporfinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Verteporfin.Approved, Investigational
VesnarinoneThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Vesnarinone.Investigational
VinblastineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Vinblastine.Approved
VincristineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Vincristine.Approved, Investigational
VindesineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Vindesine.Approved, Investigational
VinflunineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Vinflunine.Approved
VinorelbineThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Vinorelbine.Approved, Investigational
VintafolideThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Vintafolide.Investigational
VismodegibThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Vismodegib.Approved
Vitamin AThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Vitamin A.Approved, Nutraceutical, Vet Approved
VorinostatThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Vorinostat.Approved, Investigational
VorozoleThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Vorozole.Experimental
ZorubicinThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Zorubicin.Experimental
Zuretinol acetateThe risk or severity of cytotoxicity can be increased when Ancestim is combined with Zuretinol acetate.Investigational
Food Interactions
Not Available

References

General References
  1. Ronnstrand L: Signal transduction via the stem cell factor receptor/c-Kit. Cell Mol Life Sci. 2004 Oct;61(19-20):2535-48. doi: 10.1007/s00018-004-4189-6. [PubMed:15526160]
  2. Trahan P. (1999). Clinical Handbook for biotherapy. Jones and Bartlett Publishers Inc..
  3. Galbraith A., Bullock S., Manias E., Hunt B., and Richards A. (2013). Fundamentals of Pharmacology: An applied approach for nursing and health (2nd ed.). Pearson Education Limited. [ISBN:1741031443]
  4. Health Canada [Link]
  5. Sobi [Link]
  6. Stemgen monograph [Link]
  7. Stemgen monograph [Link]
External Links
PubChem Substance
347910405
Wikipedia
Ancestim
ATC Codes
L03AA12 — Ancestim
MSDS
Download (133 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0Unknown StatusTreatmentMyelodysplasia1
2CompletedTreatmentMultiple Myeloma (MM)1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
FormRouteStrength
Kit; powder, for solutionSubcutaneous
Prices
Not Available
Patents
Not Available

Properties

State
Solid
Experimental Properties
PropertyValueSource
melting point (°C)230ºC'MSDS'
boiling point (°C)520ºC at 760 mmHg'MSDS'
water solubilityInsoluble'MSDS'
isoelectric point5.86'MSDS'

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Agonist
General Function
Transmembrane receptor protein tyrosine kinase activity
Specific Function
Tyrosine-protein kinase that acts as cell-surface receptor for the cytokine KITLG/SCF and plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell main...
Gene Name
KIT
Uniprot ID
P10721
Uniprot Name
Mast/stem cell growth factor receptor Kit
Molecular Weight
109863.655 Da
References
  1. Ronnstrand L: Signal transduction via the stem cell factor receptor/c-Kit. Cell Mol Life Sci. 2004 Oct;61(19-20):2535-48. doi: 10.1007/s00018-004-4189-6. [PubMed:15526160]
  2. Barnett A. (2012). Type 2 diabetes (2nd ed.). Oxford.
  3. Stemgen monograph [Link]

Drug created on September 16, 2015 16:07 / Updated on December 22, 2017 11:07