Fibrinolysin

Identification

Name
Fibrinolysin
Accession Number
DB05254  (DB08977)
Type
Biotech
Groups
Investigational
Biologic Classification
Protein Based Therapies
Other protein based therapies
Description

Fibrinolysin (also known as bovine plasmin) is a bovine enzyme derived from bovine plasma or extracted from bacterial cultures. It is a globular protein with a molecular weight of ~90,000 daltons. Fibrinolysin consists of two polypeptide chains, one light and one heavy, linked by a disulfide bond. The light chain has a molecular weight of approximately 27,000 Da and contains the active center of Fibrinolysin; the heavy chain has a molecular weight of approximately 57,000 Da. Fibrinolysin is used as a local healing ointment when combined together with the enzyme deoxyribonuclease I (extracted from bovine pancreas). Fibrinolysin and deoxyribonuclease both act as lytic enzymes. The combination is available as ointment containing 1 BU (Biological Unit) Fibrinolysin and 666 BUs desoxyribonuclease per gram. The ointment is marketed by Pfizer under the brand name Fibrolan in a variety of countries (e.g. Switzerland). It is currently not approved in the USA.

Protein chemical formula
C3848H5912N1096O1185S60
Protein average weight
88411.4 Da
Sequences
>Fibrinolysin heavy chain
DLLDDYVNTQGASLLSLSRKNLAGRSVEDCAAKCEEETDFVCRAFQYHSKEQQCVVMAEN
SKNTPVFRMRDVILYEKRIYLLECKTGNGQTYRGTTAETKSGVTCQKWSATSPHVPKFSP
EKFPLAGLEENYCRNPDNDENGPWCYTTDPDKRYDYCDIPECEDKCMHCSGENYEGKIAK
TMSGRDCQAWDSQSPHAHGYIPSKFPNKNLKMNYCRNPDGEPRPWCFTTDPQKRWEFCDI
PRCTTPPPSSGPKYQCLKGTGKNYGGTVAVTESGHTCQRWSEQTPHKHNRTPENFPCKNL
EENYCRNPNGEKAPWCYTTNSEVRWEYCTIPSCESSPLSTERMDVPVPPEQTPVPQDCYH
GNGQSYRGTSSTTITGRKCQSWSSMTPHRHLKTPENYPNAGLTMNYCRNPDADKSPWCYT
TDPRVRWEFCNLKKCSETPEQVPAAPQAPGVENPPEADCMIGTGKSYRGKKATTVAGVPC
QEWAAQEPHQHSIFTPETNPQSGLERNYCRNPDGDVNGPWCYTMNPRKPFDYCDVPQCES
SFDCGKPKVEPKKCSGR
>Fibrinolysin light chain
IVGGCVSKPHSWPWQVSLRRSSRHFCGGTLISPKWVLTAAHCLDNILALSFYKVILGAHN
EKVREQSVQEIPVSRLFREPSQADIALLKLSRPAIITKEVIPACLPPPNYMVAARTECYI
TGWGETQGTFGEGLLKEAHLPVIENKVCNRNEYLDGRVKPTELCAGHLIGGTDSCQGDSG
GPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSPYVPWIEETMRRN
Download FASTA Format
Synonyms
  • Bovine Fibrinolysin
  • Bovine Plasmin
  • Fibrinolysin (human)
  • Fibrinolysin, human
  • Plasmin (bos taurus)
  • Plasmin (bovine)
  • Plasmin bovine
International/Other Brands
Elase (Pfizer) / Fibrolan (Pfizer)
Categories
UNII
A4028U842W
CAS number
9004-09-5

Pharmacology

Indication

Fibrinolysin assists with the healing of minor burns, superficial wounds, ulcers, surgical wounds, and superficial hematomas.

Structured Indications
Not Available
Pharmacodynamics
Not Available
Mechanism of action

Fibrinolysin attacks and inactivates fibrin molecules occurring in undesirable exudates on the surface of the human body and on human mucosa, e.g., in superficial wounds and burns, while desoxyribonuclease targets and destroys (human) DNA. The combination of the two enzymes has a synergistic effect on necrotic but not on living tissue.

TargetActionsOrganism
UPlasminogen activator inhibitor 1Not AvailableHuman
UUrokinase-type plasminogen activatorNot AvailableHuman
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism

local inactivation

Route of elimination
Not Available
Half life

Almost completely inactivated after 24 hours.

Clearance
Not Available
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
AbciximabFibrinolysin may increase the anticoagulant activities of Abciximab.Approved
AcenocoumarolFibrinolysin may increase the anticoagulant activities of Acenocoumarol.Approved, Investigational
Acetylsalicylic acidThe risk or severity of adverse effects can be increased when Acetylsalicylic acid is combined with Fibrinolysin.Approved, Vet Approved
AloxiprinThe risk or severity of adverse effects can be increased when Aloxiprin is combined with Fibrinolysin.Experimental
AlprostadilAlprostadil may increase the anticoagulant activities of Fibrinolysin.Approved, Investigational
Aminosalicylic AcidThe risk or severity of adverse effects can be increased when Aminosalicylic Acid is combined with Fibrinolysin.Approved
AnagrelideAnagrelide may increase the anticoagulant activities of Fibrinolysin.Approved
AncrodFibrinolysin may increase the anticoagulant activities of Ancrod.Approved, Investigational
AndrographolideAndrographolide may increase the anticoagulant activities of Fibrinolysin.Investigational
Antithrombin III humanFibrinolysin may increase the anticoagulant activities of Antithrombin III human.Approved
ApixabanFibrinolysin may increase the anticoagulant activities of Apixaban.Approved
AprotininThe therapeutic efficacy of Fibrinolysin can be decreased when used in combination with Aprotinin.Approved, Investigational, Withdrawn
ArdeparinFibrinolysin may increase the anticoagulant activities of Ardeparin.Approved, Investigational, Withdrawn
ArgatrobanFibrinolysin may increase the anticoagulant activities of Argatroban.Approved, Investigational
AzelastineAzelastine may increase the anticoagulant activities of Fibrinolysin.Approved
BalsalazideThe risk or severity of adverse effects can be increased when Balsalazide is combined with Fibrinolysin.Approved, Investigational
BecaplerminFibrinolysin may increase the anticoagulant activities of Becaplermin.Approved, Investigational
BeraprostBeraprost may increase the anticoagulant activities of Fibrinolysin.Investigational
BivalirudinFibrinolysin may increase the anticoagulant activities of Bivalirudin.Approved, Investigational
BuflomedilBuflomedil may increase the anticoagulant activities of Fibrinolysin.Experimental
ButylphthalideButylphthalide may increase the anticoagulant activities of Fibrinolysin.Investigational
CangrelorCangrelor may increase the anticoagulant activities of Fibrinolysin.Approved
Carbaspirin calciumThe risk or severity of adverse effects can be increased when Carbaspirin calcium is combined with Fibrinolysin.Experimental, Investigational
CertoparinFibrinolysin may increase the anticoagulant activities of Certoparin.Approved, Investigational
CilostazolCilostazol may increase the anticoagulant activities of Fibrinolysin.Approved, Investigational
Citric AcidFibrinolysin may increase the anticoagulant activities of Citric Acid.Approved, Nutraceutical, Vet Approved
ClopidogrelClopidogrel may increase the anticoagulant activities of Fibrinolysin.Approved
CloricromenCloricromen may increase the anticoagulant activities of Fibrinolysin.Experimental
Dabigatran etexilateFibrinolysin may increase the anticoagulant activities of Dabigatran etexilate.Approved
DalteparinFibrinolysin may increase the anticoagulant activities of Dalteparin.Approved
DanaparoidFibrinolysin may increase the anticoagulant activities of Danaparoid.Approved, Withdrawn
DarexabanFibrinolysin may increase the anticoagulant activities of Darexaban.Investigational
DefibrotideDefibrotide may increase the anticoagulant activities of Fibrinolysin.Approved, Investigational
DersalazineThe risk or severity of adverse effects can be increased when Dersalazine is combined with Fibrinolysin.Investigational
DesirudinFibrinolysin may increase the anticoagulant activities of Desirudin.Approved
DextranFibrinolysin may increase the anticoagulant activities of Dextran.Approved, Investigational, Vet Approved
Dextran 40Fibrinolysin may increase the anticoagulant activities of Dextran 40.Approved
Dextran 70Fibrinolysin may increase the anticoagulant activities of Dextran 70.Approved
Dextran 75Fibrinolysin may increase the anticoagulant activities of Dextran 75.Approved
DicoumarolFibrinolysin may increase the anticoagulant activities of Dicoumarol.Approved
DiflunisalThe risk or severity of adverse effects can be increased when Diflunisal is combined with Fibrinolysin.Approved, Investigational
DipyridamoleDipyridamole may increase the anticoagulant activities of Fibrinolysin.Approved
Edetic AcidFibrinolysin may increase the anticoagulant activities of Edetic Acid.Approved, Vet Approved
EdoxabanFibrinolysin may increase the anticoagulant activities of Edoxaban.Approved
EnoxaparinFibrinolysin may increase the anticoagulant activities of Enoxaparin.Approved
EpinastineEpinastine may increase the anticoagulant activities of Fibrinolysin.Approved, Investigational
EplivanserinEplivanserin may increase the anticoagulant activities of Fibrinolysin.Investigational
eplivanserineeplivanserine may increase the anticoagulant activities of Fibrinolysin.Investigational
EpoprostenolEpoprostenol may increase the anticoagulant activities of Fibrinolysin.Approved
EptifibatideEptifibatide may increase the anticoagulant activities of Fibrinolysin.Approved, Investigational
Ethyl biscoumacetateFibrinolysin may increase the anticoagulant activities of Ethyl biscoumacetate.Withdrawn
Ferulic acidFibrinolysin may increase the anticoagulant activities of Ferulic acid.Experimental
FluindioneFibrinolysin may increase the anticoagulant activities of Fluindione.Approved, Investigational
FondaparinuxFibrinolysin may increase the anticoagulant activities of Fondaparinux.Approved, Investigational
Fondaparinux sodiumFibrinolysin may increase the anticoagulant activities of Fondaparinux sodium.Approved, Investigational
GabexateFibrinolysin may increase the anticoagulant activities of Gabexate.Investigational
GuacetisalThe risk or severity of adverse effects can be increased when Guacetisal is combined with Fibrinolysin.Experimental
Hemoglobin crosfumarilThe risk or severity of adverse effects can be increased when Hemoglobin crosfumaril is combined with Fibrinolysin.Experimental
HeparinFibrinolysin may increase the anticoagulant activities of Heparin.Approved, Investigational
HydroxytyrosolHydroxytyrosol may increase the anticoagulant activities of Fibrinolysin.Investigational
IbudilastIbudilast may increase the anticoagulant activities of Fibrinolysin.Approved, Investigational
Icosapent ethylIcosapent ethyl may increase the anticoagulant activities of Fibrinolysin.Approved, Investigational, Nutraceutical
IdraparinuxFibrinolysin may increase the anticoagulant activities of Idraparinux.Investigational
IfenprodilIfenprodil may increase the anticoagulant activities of Fibrinolysin.Approved, Investigational, Withdrawn
IfetrobanIfetroban may increase the anticoagulant activities of Fibrinolysin.Investigational
IloprostIloprost may increase the anticoagulant activities of Fibrinolysin.Approved, Investigational
IndobufenIndobufen may increase the anticoagulant activities of Fibrinolysin.Investigational
KetanserinKetanserin may increase the anticoagulant activities of Fibrinolysin.Investigational
LepirudinFibrinolysin may increase the anticoagulant activities of Lepirudin.Approved
LetaxabanFibrinolysin may increase the anticoagulant activities of Letaxaban.Investigational
LimaprostThe risk or severity of adverse effects can be increased when Limaprost is combined with Fibrinolysin.Approved, Investigational
LinsidomineLinsidomine may increase the anticoagulant activities of Fibrinolysin.Experimental
MelagatranFibrinolysin may increase the anticoagulant activities of Melagatran.Experimental
MesalazineThe risk or severity of adverse effects can be increased when Mesalazine is combined with Fibrinolysin.Approved
Methyl salicylateThe risk or severity of adverse effects can be increased when Methyl salicylate is combined with Fibrinolysin.Approved, Vet Approved
MilrinoneMilrinone may increase the anticoagulant activities of Fibrinolysin.Approved
NadroparinFibrinolysin may increase the anticoagulant activities of Nadroparin.Approved, Investigational
NafamostatFibrinolysin may increase the anticoagulant activities of Nafamostat.Approved, Investigational
NaftopidilNaftopidil may increase the anticoagulant activities of Fibrinolysin.Investigational
NimesulideNimesulide may increase the anticoagulant activities of Fibrinolysin.Approved, Investigational, Withdrawn
NitroaspirinThe risk or severity of adverse effects can be increased when Nitroaspirin is combined with Fibrinolysin.Investigational
OlsalazineThe risk or severity of adverse effects can be increased when Olsalazine is combined with Fibrinolysin.Approved
OtamixabanFibrinolysin may increase the anticoagulant activities of Otamixaban.Investigational
Pentaerythritol TetranitrateFibrinolysin may increase the anticoagulant activities of Pentaerythritol Tetranitrate.Approved
Pentosan PolysulfateFibrinolysin may increase the anticoagulant activities of Pentosan Polysulfate.Approved
PentoxifyllinePentoxifylline may increase the anticoagulant activities of Fibrinolysin.Approved, Investigational
PhenindioneFibrinolysin may increase the anticoagulant activities of Phenindione.Approved, Investigational
PhenprocoumonFibrinolysin may increase the anticoagulant activities of Phenprocoumon.Approved, Investigational
Phenyl aminosalicylateThe risk or severity of adverse effects can be increased when Phenyl aminosalicylate is combined with Fibrinolysin.Approved
PicotamidePicotamide may increase the anticoagulant activities of Fibrinolysin.Experimental
PrasugrelPrasugrel may increase the anticoagulant activities of Fibrinolysin.Approved
Protein CFibrinolysin may increase the anticoagulant activities of Protein C.Approved
Protein S humanFibrinolysin may increase the anticoagulant activities of Protein S human.Approved
ProtocatechualdehydeFibrinolysin may increase the anticoagulant activities of Protocatechualdehyde.Approved
RamatrobanRamatroban may increase the anticoagulant activities of Fibrinolysin.Investigational
RelcovaptanRelcovaptan may increase the anticoagulant activities of Fibrinolysin.Investigational
ResveratrolResveratrol may increase the anticoagulant activities of Fibrinolysin.Approved, Experimental, Investigational
ReviparinFibrinolysin may increase the anticoagulant activities of Reviparin.Approved, Investigational
RidogrelRidogrel may increase the anticoagulant activities of Fibrinolysin.Approved
RivaroxabanFibrinolysin may increase the anticoagulant activities of Rivaroxaban.Approved
Salicylic acidThe risk or severity of adverse effects can be increased when Salicylic acid is combined with Fibrinolysin.Approved, Investigational, Vet Approved
SarpogrelateSarpogrelate may increase the anticoagulant activities of Fibrinolysin.Investigational
SevofluraneSevoflurane may increase the anticoagulant activities of Fibrinolysin.Approved, Vet Approved
SRT501SRT501 may increase the anticoagulant activities of Fibrinolysin.Investigational
SulodexideFibrinolysin may increase the anticoagulant activities of Sulodexide.Approved, Investigational
TesmilifeneTesmilifene may increase the anticoagulant activities of Fibrinolysin.Investigational
TicagrelorTicagrelor may increase the anticoagulant activities of Fibrinolysin.Approved
TiclopidineTiclopidine may increase the anticoagulant activities of Fibrinolysin.Approved
TirofibanTirofiban may increase the anticoagulant activities of Fibrinolysin.Approved
TranilastTranilast may increase the anticoagulant activities of Fibrinolysin.Approved, Investigational
TrapidilTrapidil may increase the anticoagulant activities of Fibrinolysin.Approved
TreprostinilThe risk or severity of adverse effects can be increased when Fibrinolysin is combined with Treprostinil.Approved, Investigational
TriflusalTriflusal may increase the anticoagulant activities of Fibrinolysin.Approved, Investigational
Trolamine salicylateThe risk or severity of adverse effects can be increased when Trolamine salicylate is combined with Fibrinolysin.Approved
TroxerutinFibrinolysin may increase the anticoagulant activities of Troxerutin.Investigational
VorapaxarVorapaxar may increase the anticoagulant activities of Fibrinolysin.Approved
WarfarinFibrinolysin may increase the anticoagulant activities of Warfarin.Approved
XimelagatranFibrinolysin may increase the anticoagulant activities of Ximelagatran.Approved, Investigational, Withdrawn
Food Interactions
Not Available

References

Synthesis Reference

U.S. Patent 2,624,691; U.S. Patent 3,136,703; U.S. Patent 3,234,106.

General References
  1. Birk Y, Khalef S, Jibson MD: Purification and properties of protease F, a bacterial enzyme with chymotrypsin and elastase specificities. Arch Biochem Biophys. 1983 Sep;225(2):451-7. [PubMed:6226244]
External Links
PubChem Substance
347910050
Wikipedia
Plasmin
ATC Codes
B01AD05 — FibrinolysinB06AA02 — Fibrinolysin and desoxyribonuclease

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1CompletedTreatmentArterial Occlusive Diseases1
1, 2CompletedTreatmentAcute Ischemic Stroke (AIS)1
1, 2TerminatedTreatmentDisorders Caused by Vitreo-retinal Traction1
2CompletedTreatmentAcute Peripheral Arterial Occlusion1
2TerminatedTreatmentDisorders Caused by Vitreo-retinal Traction1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Not Available
Dosage forms
Not Available
Prices
Not Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US2624691No1953-01-061980-01-06Us
US3136703No1964-06-091981-06-09Us
US3234106No1966-02-081983-02-08Us

Properties

State
Liquid
Experimental Properties
Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type endopeptidase inhibitor activity
Specific Function
Serine protease inhibitor. This inhibitor acts as 'bait' for tissue plasminogen activator, urokinase, protein C and matriptase-3/TMPRSS7. Its rapid interaction with PLAT may function as a major con...
Gene Name
SERPINE1
Uniprot ID
P05121
Uniprot Name
Plasminogen activator inhibitor 1
Molecular Weight
45059.695 Da
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type endopeptidase activity
Specific Function
Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.
Gene Name
PLAU
Uniprot ID
P00749
Uniprot Name
Urokinase-type plasminogen activator
Molecular Weight
48507.09 Da

Drug created on November 18, 2007 11:09 / Updated on March 02, 2018 03:02