Inositol 1,4,5-trisphosphate receptor type 1

Details

Name
Inositol 1,4,5-trisphosphate receptor type 1
Synonyms
  • INSP3R1
  • IP3 receptor isoform 1
  • IP3R 1
  • Type 1 inositol 1,4,5-trisphosphate receptor
  • Type 1 InsP3 receptor
Gene Name
ITPR1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0009443|Inositol 1,4,5-trisphosphate receptor type 1
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPETGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEGVSSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDA
KEGQKEDRDVLSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRA
SFCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGASKDEIKERFAQTMEF
VEEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVH
VTTIFPISKMAKGEENKGNNDVEKLKSSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAA
PEGNVKQAEPEKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSE
TSSGNSSQEGPSNVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMH
DYPPLVSGALQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSE
LWVYKGQGPDETMDGASGENEHKKTEEGNNKPQKHESTSSYNYRVVKEILIRLSKLCVQE
SASVRKSRKQQQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQ
NQALLHKHINLFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIK
FLQTIVKAEGKFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSP
LMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCY
VDTEVEMKEIYTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFF
SSPFSDQSTTLQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAI
PVDLDSQVNNLFLKSHSIVQKTAMNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSAL
EDRLRPLVQAELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKL
CIKVLQTLREMMTKDRGYGEKLISIDELDNAELPPAPDSENATEELEPSPPLRQLEDHKR
GEALRQVLVNRYYGNVRPSGRRESLTSFGNGPLSAGGPGKPGGGGGGSGSSSMSRGEMSL
AEVQCHLDKEGASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDKK
SEKFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPTTQITEEV
RDQLLEASAATRKAFTTFRREADPDDHYQPGEGTQATADKAKDDLEMSAVITIMQPILRF
LQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVAL
INQTLESLTEYCQGPCHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKNNA
SKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYMQGEVEFEDGENGEDGAASPRNV
GHNIYILAHQLARHNKELQSMLKPGGQVDGDEALEFYAKHTAQIEIVRLDRTMEQIVFPV
PSICEFLTKESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCARN
MSFWSSISFNLAVLMNLLVAFFYPFKGVRGGTLEPHWSGLLWTAMLISLAIVIALPKPHG
IRALIASTILRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGYRAMVLDVEF
LYHLLYLVICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILV
YLFSIVGYLFFKDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVESGENCSSPAPRE
ELVPAEETEQDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLL
FFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHI
KEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSDSEGEQ
NELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPPHMNVNPQQPA
Number of residues
2758
Molecular Weight
313926.375
Theoretical pI
Not Available
GO Classification
Functions
calcium channel inhibitor activity / calcium ion transmembrane transporter activity / inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity / intracellular ligand-gated calcium channel activity / phosphatidylinositol binding
Processes
activation of phospholipase C activity / blood coagulation / calcium ion transport / endoplasmic reticulum calcium ion homeostasis / energy reserve metabolic process / epidermal growth factor receptor signaling pathway / epithelial fluid transport / Fc-epsilon receptor signaling pathway / Fc-gamma receptor signaling pathway involved in phagocytosis / fibroblast growth factor receptor signaling pathway / innate immune response / inositol phosphate-mediated signaling / intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress / negative regulation of calcium-mediated signaling / neurotrophin TRK receptor signaling pathway / platelet activation / post-embryonic development / regulation of insulin secretion / release of sequestered calcium ion into cytosol / response to hypoxia / signal transduction / small molecule metabolic process / stimulatory C-type lectin receptor signaling pathway / vascular endothelial growth factor receptor signaling pathway / voluntary musculoskeletal movement
Components
calcineurin complex / endoplasmic reticulum / endoplasmic reticulum membrane / integral component of membrane / membrane / nuclear inner membrane / nucleolus / platelet dense granule membrane / platelet dense tubular network / platelet dense tubular network membrane / postsynaptic density / sarcoplasmic reticulum
General Function
Phosphatidylinositol binding
Specific Function
Intracellular channel that mediates calcium release from the endoplasmic reticulum following stimulation by inositol 1,4,5-trisphosphate. Involved in the regulation of epithelial secretion of electrolytes and fluid through the interaction with AHCYL1 (By similarity). Plays a role in ER stress-induced apoptosis. Cytoplasmic calcium released from the ER triggers apoptosis by the activation of CaM kinase II, eventually leading to the activation of downstream apoptosis pathways (By similarity).
Pfam Domain Function
Transmembrane Regions
2283-2303 2315-2335 2362-2382 2406-2426 2449-2469 2578-2598
Cellular Location
Endoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0013163|Inositol 1,4,5-trisphosphate receptor type 1 (ITPR1)
ATGTCTGACAAAATGTCTAGCTTCCTACATATTGGAGACATTTGTTCTCTGTACGCGGAG
GGATCGACAAATGGATTTATTAGCACCTTGGGCCTGGTTGATGATCGTTGTGTTGTACAG
CCAGAAACCGGGGACCTTAACAATCCACCTAAGAAATTCAGAGACTGCCTCTTTAAGCTA
TGTCCCATGAACCGCTACTCTGCCCAAAAGCAGTTCTGGAAAGCCGCTAAGCCTGGGGCC
AACAGCACCACAGACGCAGTGCTACTCAACAAACTGCACCACGCTGCAGACTTGGAAAAG
AAGCAGAATGAGACAGAAAACAGGAAATTGCTGGGGACCGTAATCCAGTATGGCAATGTG
ATCCAGCTCCTGCATTTGAAAAGTAATAAATACCTAACAGTGAATAAGAGGCTTCCTGCT
CTGTTGGAGAAGAATGCCATGAGAGTCACATTGGACGAGGCTGGAAATGAAGGGTCCTGG
TTTTATATTCAGCCATTCTACAAGCTGCGATCCATTGGAGACAGCGTGGTCATAGGTGAC
AAGGTGGTTCTGAACCCCGTCAATGCTGGTCAGCCCCTACATGCTAGCAGCCATCAACTG
GTAGATAACCCAGGCTGCAATGAGGTCAATTCCGTCAACTGCAATACAAGCTGGAAAATA
GTCCTTTTCATGAAATGGAGTGATAACAAAGACGACATATTAAAGGGGGGTGACGTGGTG
AGGCTGTTTCATGCTGAGCAGGAGAAGTTTCTCACCTGTGACGAACACAGGAAGAAGCAG
CACGTCTTCCTGAGAACCACGGGCCGGCAGTCGGCCACATCTGCCACCAGTTCAAAAGCC
CTGTGGGAGGTGGAGGTGGTCCAGCATGACCCATGTCGGGGCGGAGCAGGGTATTGGAAC
AGCCTTTTCCGTTTCAAGCATCTGGCCACGGGGCATTACTTGGCAGCAGAGGTAGACCCT
GACTTTGAGGAAGAATGCCTGGAGTTTCAGCCCTCAGTGGACCCTGATCAGGACGCCTCT
CGAAGTAGGTTGCGGAATGCCCAAGAAAAGATGGTATACTCCCTGGTCTCTGTGCCTGAA
GGCAATGACATCTCCTCCATTTTCGAGCTAGATCCCACCACTCTGCGTGGAGGTGACAGC
CTTGTCCCAAGGAACTCTTATGTTCGGCTCAGACACCTATGTACTAATACCTGGGTTCAC
AGCACAAATATTCCTATTGACAAGGAAGAAGAAAAGCCCGTGATGCTGAAAATTGGCACC
TCTCCTGTGAAGGAGGATAAGGAAGCATTTGCCATAGTTCCGGTTTCTCCTGCTGAAGTT
CGGGACCTGGACTTTGCCAATGATGCCAGCAAGGTGCTGGGCTCCATTGCTGGGAAGCTA
GAGAAGGGCACCATCACCCAGAATGAAAGGAGGTCTGTAACCAAGCTGCTAGAAGATTTG
GTTTACTTCGTCACTGGTGGAACTAATTCTGGTCAAGATGTTCTCGAAGTTGTCTTCTCC
AAGCCCAACAGAGAACGGCAGAAACTGATGAGAGAACAGAATATTCTCAAGCAGATCTTC
AAGTTGTTACAAGCCCCATTCACAGACTGCGGTGATGGCCCAATGCTTCGGCTGGAAGAG
CTCGGGGACCAGCGGCACGCTCCTTTCAGACACATCTGCCGGCTCTGCTACAGGGTGCTG
AGACACTCGCAGCAAGACTACAGGAAGAACCAGGAGTATATAGCCAAGCAGTTTGGCTTC
ATGCAGAAGCAGATTGGCTATGATGTGTTGGCTGAAGACACTATCACTGCCCTGCTCCAC
AATAATCGGAAACTCCTGGAAAAACACATTACCGCGGCAGAGATTGACACATTTGTCAGC
CTGGTGCGAAAGAACAGGGAGCCCAGATTCTTAGATTACCTCTCCGACCTCTGTGTCTCC
ATGAACAAATCAATTCCAGTGACCCAGGAACTGATATGTAAAGCTGTGCTGAACCCCACC
AACGCTGACATCCTGATTGAGACCAAGTTGGTTCTTTCTCGTTTTGAATTTGAAGGTGTC
TCTTCCACTGGAGAGAATGCTCTGGAGGCAGGAGAAGACGAGGAAGAGGTGTGGCTGTTT
TGGAGGGACAGCAACAAAGAGATTCGCAGCAAGAGTGTGAGGGAATTGGCTCAGGATGCT
AAAGAAGGGCAGAAGGAGGACCGAGACGTTCTCAGCTACTACAGATATCAGCTGAACCTC
TTTGCGAGGATGTGTCTGGACCGCCAATACCTGGCCATCAACGAAATCTCAGGCCAGCTG
GATGTCGATCTCATTCTCCGCTGCATGTCTGACGAGAACCTGCCCTATGACCTCAGGGCG
TCCTTCTGCCGCCTCATGCTTCACATGCATGTGGACCGAGATCCCCAGGAACAAGTCACC
CCCGTGAAATATGCCCGCCTCTGGTCGGAGATTCCCTCGGAGATCGCCATTGACGACTAT
GATAGTAGTGGAGCTTCCAAAGATGAAATTAAGGAGAGATTTGCTCAGACCATGGAGTTT
GTGGAGGAGTATTTAAGAGATGTGGTTTGTCAGAGGTTCCCTTTCTCTGATAAAGAGAAG
AATAAGCTTACGTTTGAGGTTGTAAATTTAGCTAGGAATCTCATATACTTTGGTTTCTAC
AACTTCTCTGACCTTCTACGATTAACTAAGATCCTTCTGGCCATATTGGACTGTGTACAT
GTGACAACAATCTTCCCCATTAGCAAGATGGCGAAAGGAGAAGAGAATAAAGGCAGTAAC
GTGATGAGATCTATTCATGGCGTGGGAGAGCTGATGACCCAGGTGGTGCTCCGGGGAGGA
GGCTTTTTGCCCATGACTCCCATGGCTGCTGCCCCTGAAGGCAATGTGAAGCAGGCAGAG
CCTGAGAAGGAGGACATCATGGTCATGGACACCAAGCTGAAGATCATTGAGATACTCCAG
TTTATTTTGAATGTGAGGTTGGATTATAGGATCTCCTGCCTCCTGTGTATATTTAAGCGA
GAGTTTGATGAAAGCAATTCCCAGACTTCAGAAACATCCTCCGGAAACAGCAGCCAAGAA
GGGCCAAGTAATGTACCAGGTGCTCTTGACTTTGAACACATTGAAGAACAAGCAGAAGGC
ATCTTTGGAGGAAGTGAGGAGAACACCCCACTGGACTTGGATGACCACGGCGGCAGAACC
TTTCTCCGTGTCCTGCTCCACTTGACGATGCATGACTACCCACCCCTGGTGTCAGGGGCC
CTGCAGCTCCTCTTCCGGCACTTCAGCCAGAGGCAGGAGGTGCTCCAGGCCTTCAAACAG
GTTCAACTGCTGGTTACCAGCCAAGATGTGGACAACTACAAACAGATCAAACAAGACTTG
GATCAACTGAGGTCCATCGTGGAAAAGTCAGAGCTTTGGGTGTACAAAGGGCAGGGCCCC
GATGAGACTATGGATGGTGCATCTGGAGAAAATGAACATAAGAAAACGGAGGAGGGAAAT
AACAAGCCACAAAAGCATGAAAGCACCAGCAGCTACAACTACAGAGTGGTCAAAGAGATT
TTGATTCGGCTTAGCAAACTCTGTGTTCAAGAGAGTGCCTCAGTGAGAAAGAGCAGGAAG
CAGCAACAGCGTCTGCTCCGGAACATGGGCGCGCACGCCGTGGTGCTGGAGCTGCTGCAG
ATTCCCTATGAGAAGGCCGAAGATACCAAGATGCAAGAGATAATGAGGTTGGCTCATGAA
TTTTTGCAGAATTTCTGCGCAGGCAACCAGCAGAATCAAGCTTTGCTACATAAACACATA
AACCTGTTTCTCAACCCAGGGATCCTGGAGGCAGTAACCATGCAGCACATCTTCATGAAC
AATTTCCAGCTTTGCAGTGAGATCAACGAGAGAGTTGTTCAGCACTTCGTTCACTGCATA
GAGACTCACGGTCGGAATGTCCAGTATATAAAGTTCTTACAGACAATTGTCAAGGCAGAA
GGGAAATTTATTAAAAAATGCCAAGACATGGTTATGGCCGAGCTGGTCAATTCGGGAGAG
GATGTCCTCGTGTTCTACAACGACAGAGCCTCTTTCCAGACTCTGATCCAGATGATGCGG
TCAGAACGGGATCGGATGGATGAGAACAGCCCTCTCATGTACCACATCCACTTGGTCGAG
CTCCTGGCTGTGTGCACGGAGGGTAAGAATGTCTACACAGAGATCAAGTGCAACTCCCTG
CTCCCGCTGGATGACATCGTTCGCGTGGTGACCCACGAGGACTGCATCCCTGAGGTTAAA
ATTGCATACATTAACTTCCTGAATCACTGCTATGTGGATACAGAGGTGGAAATGAAGGAG
ATTTATACCAGCAATCACATGTGGAAATTGTTTGAGAATTTCCTTGTAGACATCTGCAGG
GCCTGTAACAACACTAGTGACAGGAAACATGCAGACTCGATTTTGGAGAAGTATGTCACC
GAAATCGTCATGAGTATTGTTACTACTTTCTTCAGCTCTCCCTTCTCAGACCAGAGTACG
ACTTTGCAGACTCGCCAGCCTGTCTTTGTGCAACTGCTGCAAGGCGTGTTCAGGGTTTAC
CACTGCAACTGGTTAATGCCAAGCCAAAAAGCCTCCGTGGAGAGCTGTATTCGGGTGCTG
TCTGATGTAGCCAAGAGCCGGGCCATTGCCATTCCCGTGGACCTGGACAGCCAAGTCAAC
AACCTCTTTCTCAAGTCCCACAGCATTGTGCAGAAAACAGCCATGAACTGGCGGCTCTCA
GCCCGCAATGCCGCACGCAGGGACTCTGTTCTGGCAGCTTCCAGAGACTACCGGAATATC
ATTGAGAGATTGCAGGACATCGTCTCCGCGCTGGAGGACCGTCTCAGGCCCCTGGTGCAG
GCAGAGTTATCTGTGCTCGTGGATGTTCTCCACAGACCCGAGCTGCTTTTCCCAGAGAAC
ACAGACGCCAGAAGGAAATGTGAAAGTGGCGGTTTCATTTGCAAGTTAATAAAGCATACA
AAACAGCTGCTAGAAGAAAATGAAGAGAAGCTCTGCATTAAGGTCCTACAGACCCTGAGG
GAAATGATGACCAAAGATAGAGGCTATGGAGAAAAGGGTGAGGCGCTCAGGCAAGTTCTG
GTCAACCGTTACTATGGAAACGTCAGACCTTCGGGACGAAGAGAGAGCCTTACCAGCTTT
GGCAATGGCCCACTGTCAGCAGGAGGACCCGGCAAGCCCGGGGGAGGAGGGGGAGGTTCC
GGATCCAGCTCTATGAGCAGGGGTGAGATGAGTCTGGCCGAGGTTCAGTGTCACCTTGAC
AAGGAGGGGGCTTCCAATCTAGTTATCGACCTCATCATGAACGCATCCAGTGACCGAGTG
TTCCATGAAAGCATTCTCCTGGCCATTGCCCTTCTGGAAGGAGGCAACACCACCATCCAG
CACTCCTTTTTCTGTCGCTTGACAGAAGATAAGAAGTCAGAGAAATTCTTTAAGGTGTTT
TATGACCGGATGAAGGTGGCCCAGCAAGAAATCAAAGCAACAGTGACAGTGAACACCAGT
GACTTGGGAAATAAAAAGAAAGACGATGAGGTAGACAGGGATGCCCCATCACGGAAAAAA
GCTAAAGAGCCCACAACACAGATAACAGAAGAGGTCCGGGATCAGCTCCTGGAGGCCTCC
GCTGCCACCAGGAAAGCCTTCACCACTTTCAGGAGGGAGGCTGATCCCGACGACCACTAC
CAGCCTGGAGAGGGCACCCAGGCCACTGCCGACAAGGCCAAGGACGACCTGGAGATGAGC
GCGGTCATCACCATCATGCAGCCCATCCTCCGCTTCCTTCAGCTCCTGTGTGAAAACCAC
AACCGAGACCTGCAGAACTTCCTCCGTTGCCAAAATAACAAGACCAACTACAATTTGGTA
TGTGAGACCCTGCAGTTTCTGGACTGTATTTGTGGAAGCACAACTGGAGGCCTTGGTCTT
CTGGGCTTGTATATAAATGAAAAGAACGTAGCGCTTATCAACCAAACCCTGGAAAGTCTG
ACCGAATACTGTCAAGGACCTTGCCATGAGAACCAGAACTGCATAGCCACCCATGAATCC
AATGGCATTGACATCATCACAGCCCTGATCCTCAATGATATCAATCCTTTGGGAAAGAAG
AGGATGGACCTTGTGTTAGAACTGAAGAACAATGCCTCGAAGTTGCTCCTGGCCATCATG
GAAAGCAGGCACGACAGTGAAAACGCAGAGAGGATACTTTATAACATGAGGCCCAAGGAA
CTGGTGGAAGTGATCAAGAAAGCCTACATGCAAGGTGAAGTGGAATTTGAGGATGGAGAA
AACGGTGAGGATGGGGCGGCGTCCCCCAGGAACGTGGGGCACAACATCTACATATTAGCC
CATCAGTTGGCTCGGCATAACAAAGAACTTCAGAGCATGCTGAAACCTGGTGGCCAAGTG
GACGGAGATGAAGCCCTGGAGTTTTATGCCAAGCACACGGCGCAGATAGAGATTGTCAGA
TTAGACCGAACAATGGAACAGATAGTCTTTCCCGTGCCCAGCATATGTGAATTCCTAACC
AAGGAGTCAAAACTACGAATTTACTATACTACAGAGAGAGACGAACAAGGCAGCAAAATC
AATGATTTCTTTCTGCGGTCTGAAGACCTCTTCAATGAAATGAATTGGCAGAAGAAACTG
AGAGCCCAGCCCGTGTTGTACTGGTGTGCCCGCAACATGTCTTTCTGGAGCAGCATTTCG
TTTAACCTGGCCGTCCTGATGAACCTGCTGGTGGCGTTTTTCTACCCGTTTAAGGGAGTC
CGAGGAGGAACCCTGGAGCCCCACTGGTCGGGACTCCTGTGGACAGCCATGCTCATCTCT
CTGGCCATCGTCATTGCCCTCCCCAAGCCCCATGGCATCCGGGCCTTAATTGCCTCCACA
ATTCTACGACTGATATTTTCAGTCGGGTTACAACCCACGTTGTTTCTTCTGGGCGCTTTC
AATGTATGCAATAAAATCATCTTTCTAATGAGCTTTGTGGGCAACTGTGGGACATTCACA
AGAGGCTACCGAGCCATGGTTCTGGATGTTGAGTTCCTCTATCATTTGTTGTATCTGGTG
ATCTGTGCCATGGGGCTCTTTGTCCATGAATTCTTCTACAGTCTGCTGCTTTTTGATTTA
GTGTACAGAGAAGAGACTTTGCTTAATGTCATTAAAAGTGTCACTCGCAATGGACGGTCC
ATCATCCTGACAGCAGTTCTGGCTCTGATCCTCGTTTACCTGTTCTCAATAGTGGGCTAT
CTTTTCTTCAAGGATGACTTTATCTTGGAAGTAGATAGGCTGCCCAATGAAACAGCTGTT
CCAGAAACCGGCGAGAGTTTGGCAAGCGAGTTCCTGTTCTCCGATGTGTGTAGGGTGGAG
AGTGGGGAGAACTGCTCCTCTCCTGCACCCAGAGAAGAGCTGGTCCCTGCAGAAGAGACG
GAACAGGATAAAGAGCACACATGTGAGACGCTGCTGATGTGCATTGTCACTGTGCTGAGT
CACGGGCTGCGGAGCGGGGGTGGAGTAGGAGATGTACTCAGGAAGCCGTCCAAAGAGGAA
CCCCTGTTTGCTGCTAGAGTTATTTATGACCTCTTGTTCTTCTTCATGGTCATCATCATT
GTTCTTAACCTGATTTTTGGGGTTATCATTGACACTTTTGCTGACCTGAGGAGTGAGAAG
CAGAAGAAGGAAGAGATCTTGAAGACCACGTGCTTTATCTGTGGCTTGGAAAGAGACAAG
TTTGACAACAAGACTGTCACCTTTGAAGAGCACATCAAGGAAGAACACAACATGTGGCAC
TATCTGTGCTTCATCGTCCTGGTGAAAGTAAAGGACTCCACCGAATATACTGGGCCTGAG
AGTTACGTGGCAGAAATGATCAAGGAAAGAAACCTTGACTGGTTCCCCAGGATGAGAGCC
ATGTCATTGGTCAGCAGTGATTCTGAAGGAGAACAGAATGAGCTGAGAAACCTGCAGGAG
AAGCTGGAGTCCACCATGAAACTTGTCACGAACCTTTCTGGCCAGCTGTCGGAATTAAAG
GATCAGATGACAGAACAAAGGAAGCAGAAACAAAGAATTGGTCTTCTAGGACATCCTCCT
CACATGAATGTCAACCCACAACAACCAGCATAA
Chromosome Location
3
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ14643
UniProtKB Entry NameITPR1_HUMAN
HGNC IDHGNC:6180
General References
  1. Yamada N, Makino Y, Clark RA, Pearson DW, Mattei MG, Guenet JL, Ohama E, Fujino I, Miyawaki A, Furuichi T, et al.: Human inositol 1,4,5-trisphosphate type-1 receptor, InsP3R1: structure, function, regulation of expression and chromosomal localization. Biochem J. 1994 Sep 15;302 ( Pt 3):781-90. [PubMed:7945203]
  2. Harnick DJ, Jayaraman T, Ma Y, Mulieri P, Go LO, Marks AR: The human type 1 inositol 1,4,5-trisphosphate receptor from T lymphocytes. Structure, localization, and tyrosine phosphorylation. J Biol Chem. 1995 Feb 10;270(6):2833-40. [PubMed:7852357]
  3. Nucifora FC Jr, Li SH, Danoff S, Ullrich A, Ross CA: Molecular cloning of a cDNA for the human inositol 1,4,5-trisphosphate receptor type 1, and the identification of a third alternatively spliced variant. Brain Res Mol Brain Res. 1995 Sep;32(2):291-6. [PubMed:7500840]
  4. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997]
  5. Yan J, Khanna KK, Lavin MF: Induction of inositol 1,4,5 trisphosphate receptor genes by ionizing radiation. Int J Radiat Biol. 1996 May;69(5):539-46. [PubMed:8648241]
  6. Yang J, McBride S, Mak DO, Vardi N, Palczewski K, Haeseleer F, Foskett JK: Identification of a family of calcium sensors as protein ligands of inositol trisphosphate receptor Ca(2+) release channels. Proc Natl Acad Sci U S A. 2002 May 28;99(11):7711-6. [PubMed:12032348]
  7. Kasri NN, Holmes AM, Bultynck G, Parys JB, Bootman MD, Rietdorf K, Missiaen L, McDonald F, De Smedt H, Conway SJ, Holmes AB, Berridge MJ, Roderick HL: Regulation of InsP3 receptor activity by neuronal Ca2+-binding proteins. EMBO J. 2004 Jan 28;23(2):312-21. Epub 2003 Dec 18. [PubMed:14685260]
  8. Higo T, Hattori M, Nakamura T, Natsume T, Michikawa T, Mikoshiba K: Subtype-specific and ER lumenal environment-dependent regulation of inositol 1,4,5-trisphosphate receptor type 1 by ERp44. Cell. 2005 Jan 14;120(1):85-98. [PubMed:15652484]
  9. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983]
  10. Ando H, Mizutani A, Kiefer H, Tsuzurugi D, Michikawa T, Mikoshiba K: IRBIT suppresses IP3 receptor activity by competing with IP3 for the common binding site on the IP3 receptor. Mol Cell. 2006 Jun 23;22(6):795-806. [PubMed:16793548]
  11. Antl M, von Bruhl ML, Eiglsperger C, Werner M, Konrad I, Kocher T, Wilm M, Hofmann F, Massberg S, Schlossmann J: IRAG mediates NO/cGMP-dependent inhibition of platelet aggregation and thrombus formation. Blood. 2007 Jan 15;109(2):552-9. Epub 2006 Sep 21. [PubMed:16990611]
  12. van de Leemput J, Chandran J, Knight MA, Holtzclaw LA, Scholz S, Cookson MR, Houlden H, Gwinn-Hardy K, Fung HC, Lin X, Hernandez D, Simon-Sanchez J, Wood NW, Giunti P, Rafferty I, Hardy J, Storey E, Gardner RJ, Forrest SM, Fisher EM, Russell JT, Cai H, Singleton AB: Deletion at ITPR1 underlies ataxia in mice and spinocerebellar ataxia 15 in humans. PLoS Genet. 2007 Jun;3(6):e108. Epub 2007 May 16. [PubMed:17590087]
  13. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648]
  14. Ando H, Mizutani A, Mikoshiba K: An IRBIT homologue lacks binding activity to inositol 1,4,5-trisphosphate receptor due to the unique N-terminal appendage. J Neurochem. 2009 Apr;109(2):539-50. doi: 10.1111/j.1471-4159.2009.05979.x. Epub 2009 Feb 11. [PubMed:19220705]
  15. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218]
  16. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [PubMed:20068231]
  17. Matsuzaki H, Fujimoto T, Ota T, Ogawa M, Tsunoda T, Doi K, Hamabashiri M, Tanaka M, Shirasawa S: Tespa1 is a novel inositol 1,4,5-trisphosphate receptor binding protein in T and B lymphocytes. FEBS Open Bio. 2012 Sep 4;2:255-9. doi: 10.1016/j.fob.2012.08.005. Print 2012. [PubMed:23650607]
  18. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  19. Hara K, Shiga A, Nozaki H, Mitsui J, Takahashi Y, Ishiguro H, Yomono H, Kurisaki H, Goto J, Ikeuchi T, Tsuji S, Nishizawa M, Onodera O: Total deletion and a missense mutation of ITPR1 in Japanese SCA15 families. Neurology. 2008 Aug 19;71(8):547-51. doi: 10.1212/01.wnl.0000311277.71046.a0. Epub 2008 Jun 25. [PubMed:18579805]
  20. Huang L, Chardon JW, Carter MT, Friend KL, Dudding TE, Schwartzentruber J, Zou R, Schofield PW, Douglas S, Bulman DE, Boycott KM: Missense mutations in ITPR1 cause autosomal dominant congenital nonprogressive spinocerebellar ataxia. Orphanet J Rare Dis. 2012 Sep 17;7:67. doi: 10.1186/1750-1172-7-67. [PubMed:22986007]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB034011D-myo-inositol 1,4,5-trisphosphateexperimentalunknownDetails
DB09462Glycerinapproved, investigationalunknownDetails
DB11590ThimerosalapprovedunknownDetails
DB00201CaffeineapprovedunknowninhibitorDetails