Penicillin-binding protein 3

Details

Name
Penicillin-binding protein 3
Synonyms
  • Putative D-alanyl-D-alanine carboxypeptidase
Gene Name
pbp3
Organism
Streptococcus pneumoniae
Amino acid sequence
>lcl|BSEQ0017497|Penicillin-binding protein 3
MKKIFLTLLTVSLLGGASTAVAQDFTIAAKHAIAVEANTGKILYEKDATQPVEIASITKL
ITVYLVYEALENGSITLSTPVDISDYPYQLTTNSEASNIPMEARNYTVEELLEATLVSSA
NSAAIALAEKIAGSEKDFVDMMRAKLLEWGIQDATVVNTTGLNNETLGDNIYPGSKKDEE
NKLSAYDVAIVARNLIKKYPQVLEITKKPSSTFAGMTITSTNYMLEGMPAYRGGFDGLKT
GTTDKAGESFVGTTVEKGMRVITVVLNADHQDNNPYARFTATSSLMDYISSTFTLRKIVQ
QGDAYQDSKTPVQDGKEDTVTAVAPEDIYLIERVGNQSSQSVQFTPDSKAIPAPLEAGTV
VGHLTYEDKDLIGQGYITTERPSFEMVADKKIEKAFFLKVWWNQFVRFVNEKL
Number of residues
413
Molecular Weight
45209.84
Theoretical pI
Not Available
GO Classification
Functions
serine-type D-Ala-D-Ala carboxypeptidase activity
General Function
Serine-type d-ala-d-ala carboxypeptidase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ75Y35
UniProtKB Entry NameQ75Y35_STREE
General References
  1. Sanbongi Y, Ida T, Ishikawa M, Osaki Y, Kataoka H, Suzuki T, Kondo K, Ohsawa F, Yonezawa M: Complete sequences of six penicillin-binding protein genes from 40 Streptococcus pneumoniae clinical isolates collected in Japan. Antimicrob Agents Chemother. 2004 Jun;48(6):2244-50. [PubMed:15155228]
  2. Kosowska-Shick K, McGhee P, Appelbaum PC: Binding of faropenem and other beta-lactam agents to penicillin-binding proteins of pneumococci with various beta-lactam susceptibilities. Antimicrob Agents Chemother. 2009 May;53(5):2176-80. doi: 10.1128/AAC.01566-08. Epub 2009 Feb 23. [PubMed:19237649]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01140Cefadroxilapproved, vet_approved, withdrawnyesinhibitorDetails
DB00319PiperacillinapprovedyesinhibitorDetails
DB00607Nafcillinapproved, investigationalyesinhibitorDetails
DB00415Ampicillinapproved, vet_approvedyesinhibitorDetails
DB00485Dicloxacillinapproved, investigational, vet_approvedyesinhibitorDetails
DB01163Amdinocillininvestigational, withdrawnyesinhibitorDetails
DB01603Meticillinapproved, investigationalyesinhibitorDetails
DB00456Cefalotinapproved, investigational, vet_approvedyesinhibitorDetails
DB00713Oxacillinapproved, investigationalyesinhibitorDetails
DB01331CefoxitinapprovedyesinhibitorDetails
DB00567Cephalexinapproved, investigational, vet_approvedyesinhibitorDetails
DB03313Cephalosporin CexperimentalyesinhibitorDetails
DB00948Mezlocillinapproved, investigationalyesinhibitorDetails
DB00833CefaclorapprovedyesinhibitorDetails
DB00447Loracarbefapproved, investigational, withdrawnyesinhibitorDetails
DB00438CeftazidimeapprovedyesinhibitorDetails
DB08795AzidocillinexperimentalyesinhibitorDetails
DB00739Hetacillinapproved, vet_approved, withdrawnyesinhibitorDetails
DB01330CefotetanapprovedyesinhibitorDetails
DB01000CyclacillinapprovedyesinhibitorDetails