Organic solute transporter subunit alpha

Details

Name
Organic solute transporter subunit alpha
Synonyms
  • OST-alpha
  • OSTA
  • Solute carrier family 51 subunit alpha
Gene Name
SLC51A
Organism
Humans
Amino acid sequence
>lcl|BSEQ0017180|Organic solute transporter subunit alpha
MEPGRTQIKLDPRYTADLLEVLKTNYGIPSACFSQPPTAAQLLRALGPVELALTSILTLL
ALGSIAIFLEDAVYLYKNTLCPIKRRTLLWKSSAPTVVSVLCCFGLWIPRSLVLVEMTIT
SFYAVCFYLLMLVMVEGFGGKEAVLRTLRDTPMMVHTGPCCCCCPCCPRLLLTRKKLQLL
MLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVSTLLALWTLGIIS
RQARLHLGEQNMGAKFALFQVLLILTALQPSIFSVLANGGQIACSPPYSSKTRSQVMNCH
LLILETFLMTVLTRMYYRRKDHKVGYETFSSPDLDLNLKA
Number of residues
340
Molecular Weight
37734.575
Theoretical pI
8.63
GO Classification
Functions
protein heterodimerization activity / protein homodimerization activity / transporter activity
Processes
bile acid and bile salt transport / transport
Components
endoplasmic reticulum membrane / integral component of membrane / plasma membrane / protein complex
General Function
Transporter activity
Specific Function
Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. Efficiently transports the major species of bile acids.
Pfam Domain Function
Transmembrane Regions
49-69 88-108 119-139 182-202 219-239 256-276 295-317
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0017181|Organic solute transporter subunit alpha (SLC51A)
ATGGAGCCGGGCAGGACCCAGATAAAGCTTGACCCCAGGTACACAGCAGATCTTCTGGAG
GTGCTGAAGACCAATTACGGCATCCCCTCCGCCTGCTTCTCTCAGCCTCCCACAGCAGCC
CAACTCCTGAGAGCCCTGGGCCCTGTGGAACTTGCCCTCACTAGCATCCTGACCTTGCTG
GCGCTGGGCTCCATTGCCATCTTCCTGGAGGATGCCGTCTACCTGTACAAGAACACCCTT
TGCCCCATCAAGAGGCGGACTCTGCTCTGGAAGAGCTCGGCACCCACGGTGGTGTCTGTG
CTGTGCTGCTTTGGTCTCTGGATCCCTCGTTCCCTGGTGCTGGTGGAAATGACCATCACC
TCGTTTTATGCCGTGTGCTTTTACCTGCTGATGCTGGTCATGGTGGAAGGCTTTGGGGGG
AAGGAGGCAGTGCTGAGGACGCTGAGGGACACCCCGATGATGGTCCACACAGGCCCCTGC
TGCTGCTGCTGCCCCTGCTGTCCACGGCTGCTGCTCACCAGGAAGAAGCTTCAGCTGCTG
ATGTTGGGCCCTTTCCAATACGCCTTCTTGAAGATAACGCTGACCCTGGTGGGCCTGTTT
CTCGTCCCCGACGGCATCTATGACCCAGCAGACATTTCTGAGGGGAGCACAGCTCTATGG
ATCAACACTTTCCTTGGCGTGTCCACACTGCTGGCTCTCTGGACCCTGGGCATCATTTCC
CGTCAAGCCAGGCTACACCTGGGTGAGCAGAACATGGGAGCCAAATTTGCTCTGTTCCAG
GTTCTCCTCATCCTGACTGCCCTACAGCCCTCCATCTTCTCAGTCTTGGCCAACGGTGGG
CAGATTGCTTGTTCGCCTCCCTATTCCTCTAAAACCAGGTCTCAAGTGATGAATTGCCAC
CTCCTCATACTGGAGACTTTTCTAATGACTGTGCTGACACGAATGTACTACCGAAGGAAA
GACCACAAGGTTGGGTATGAAACTTTCTCTTCTCCAGACCTGGACTTGAACCTCAAAGCC
TAA
Chromosome Location
3
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ86UW1
UniProtKB Entry NameOSTA_HUMAN
GenBank Protein ID30348899
GenBank Gene IDAY194243
HGNC IDHGNC:29955
General References
  1. Seward DJ, Koh AS, Boyer JL, Ballatori N: Functional complementation between a novel mammalian polygenic transport complex and an evolutionarily ancient organic solute transporter, OSTalpha-OSTbeta. J Biol Chem. 2003 Jul 25;278(30):27473-82. Epub 2003 Apr 28. [PubMed:12719432]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Ballatori N, Christian WV, Lee JY, Dawson PA, Soroka CJ, Boyer JL, Madejczyk MS, Li N: OSTalpha-OSTbeta: a major basolateral bile acid and steroid transporter in human intestinal, renal, and biliary epithelia. Hepatology. 2005 Dec;42(6):1270-9. [PubMed:16317684]
  4. Landrier JF, Eloranta JJ, Vavricka SR, Kullak-Ublick GA: The nuclear receptor for bile acids, FXR, transactivates human organic solute transporter-alpha and -beta genes. Am J Physiol Gastrointest Liver Physiol. 2006 Mar;290(3):G476-85. Epub 2005 Nov 3. [PubMed:16269519]
  5. Lee H, Zhang Y, Lee FY, Nelson SF, Gonzalez FJ, Edwards PA: FXR regulates organic solute transporters alpha and beta in the adrenal gland, kidney, and intestine. J Lipid Res. 2006 Jan;47(1):201-14. Epub 2005 Oct 26. [PubMed:16251721]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04348Taurocholic AcidexperimentalunknownsubstrateDetails
DB00917DinoprostoneapprovedunknownsubstrateDetails
DB00286Conjugated estrogensapprovedunknownsubstrateDetails
DB00390DigoxinapprovedunknownsubstrateDetails