Organic solute transporter subunit beta

Details

Name
Organic solute transporter subunit beta
Synonyms
  • OST-beta
  • OSTB
  • Solute carrier family 51 subunit beta
Gene Name
SLC51B
Organism
Humans
Amino acid sequence
>lcl|BSEQ0012548|Organic solute transporter subunit beta
MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQ
ASRKEKMQPPEKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFL
PDVPETES
Number of residues
128
Molecular Weight
14346.195
Theoretical pI
4.29
GO Classification
Functions
protein heterodimerization activity / transporter activity
Processes
bile acid and bile salt transport / positive regulation of protein exit from endoplasmic reticulum / positive regulation of protein glycosylation / positive regulation of protein targeting to membrane / regulation of protein stability
Components
integral component of membrane / plasma membrane / protein complex
General Function
Transporter activity
Specific Function
Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. Efficiently transports the major species of bile acids. Modulates SLC51A glycosylation, membrane trafficking and stability activities.
Pfam Domain Function
Transmembrane Regions
36-56
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0012549|Organic solute transporter subunit beta (SLC51B)
ATGGAGCACAGTGAGGGGGCTCCCGGAGACCCAGCCGGTACTGTGGTACCCCAGGAGCTG
CTGGAAGAGATGCTTTGGTTTTTTCGTGTGGAAGATGCATCTCCCTGGAATCATTCCATC
CTTGCCCTGGCAGCTGTGGTGGTCATTATAAGCATGGTCCTCCTGGGAAGAAGCATCCAG
GCAAGCAGAAAAGAAAAGATGCAGCCACCAGAAAAAGAAACTCCAGAAGTCCTGCATTTG
GATGAGGCCAAGGATCACAACAGCCTAAACAACCTAAGAGAAACTTTGCTCTCAGAAAAG
CCAAACTTGGCCCAGGTGGAACTTGAGTTAAAAGAGAGAGATGTGCTGTCAGTTTTCCTT
CCGGATGTACCAGAAACTGAGAGCTAG
Chromosome Location
15
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ86UW2
UniProtKB Entry NameOSTB_HUMAN
GenBank Protein ID30348897
GenBank Gene IDAY194242
HGNC IDHGNC:29956
General References
  1. Seward DJ, Koh AS, Boyer JL, Ballatori N: Functional complementation between a novel mammalian polygenic transport complex and an evolutionarily ancient organic solute transporter, OSTalpha-OSTbeta. J Biol Chem. 2003 Jul 25;278(30):27473-82. Epub 2003 Apr 28. [PubMed:12719432]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  3. Ballatori N, Christian WV, Lee JY, Dawson PA, Soroka CJ, Boyer JL, Madejczyk MS, Li N: OSTalpha-OSTbeta: a major basolateral bile acid and steroid transporter in human intestinal, renal, and biliary epithelia. Hepatology. 2005 Dec;42(6):1270-9. [PubMed:16317684]
  4. Landrier JF, Eloranta JJ, Vavricka SR, Kullak-Ublick GA: The nuclear receptor for bile acids, FXR, transactivates human organic solute transporter-alpha and -beta genes. Am J Physiol Gastrointest Liver Physiol. 2006 Mar;290(3):G476-85. Epub 2005 Nov 3. [PubMed:16269519]
  5. Lee H, Zhang Y, Lee FY, Nelson SF, Gonzalez FJ, Edwards PA: FXR regulates organic solute transporters alpha and beta in the adrenal gland, kidney, and intestine. J Lipid Res. 2006 Jan;47(1):201-14. Epub 2005 Oct 26. [PubMed:16251721]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04348Taurocholic acidapproved, experimentalunknownsubstrateDetails
DB00917DinoprostoneapprovedunknownsubstrateDetails
DB00286Conjugated estrogensapprovedunknownsubstrateDetails
DB00390DigoxinapprovedunknownsubstrateDetails