Outer membrane protein F
Details
- Name
- Outer membrane protein F
- Synonyms
- cmlB
- coa
- cry
- Outer membrane protein 1A
- Outer membrane protein B
- Outer membrane protein IA
- Porin OmpF
- tolF
- Gene Name
- ompF
- Organism
- Escherichia coli (strain K12)
- Amino acid sequence
>lcl|BSEQ0011111|Outer membrane protein F MMKRNILAVIVPALLVAGTANAAEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDM TYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDY GRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYL GKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGL KYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKS KAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVY QF
- Number of residues
- 362
- Molecular Weight
- 39333.105
- Theoretical pI
- 4.53
- GO Classification
- Functionscolicin transmembrane transporter activity / drug transmembrane transporter activity / ion transmembrane transporter activity / porin activityProcessesbacteriocin transport / drug transmembrane transport / ion transmembrane transportComponentscell outer membrane / pore complex
- General Function
- Porin activity
- Specific Function
- Forms pores that allow passive diffusion of small molecules across the outer membrane. It is also a receptor for the bacteriophage T2.
- Pfam Domain Function
- Porin_1 (PF00267)
- Transmembrane Regions
- 23-28 30-45 61-73 76-88 105-113 116-122 157-163 172-181 194-204 206-217 233-244 246-257 275-287 290-303 314-325 328-337 353-362
- Cellular Location
- Cell outer membrane
- Gene sequence
>lcl|BSEQ0011112|Outer membrane protein F (ompF) ATGATGAAGCGCAATATTCTGGCAGTGATCGTCCCTGCTCTGTTAGTAGCAGGTACTGCA AACGCTGCAGAAATCTATAACAAAGATGGCAACAAAGTAGATCTGTACGGTAAAGCTGTT GGTCTGCATTATTTTTCCAAGGGTAACGGTGAAAACAGTTACGGTGGCAATGGCGACATG ACCTATGCCCGTCTTGGTTTTAAAGGGGAAACTCAAATCAATTCCGATCTGACCGGTTAT GGTCAGTGGGAATATAACTTCCAGGGTAACAACTCTGAAGGCGCTGACGCTCAAACTGGT AACAAAACGCGTCTGGCATTCGCGGGTCTTAAATACGCTGACGTTGGTTCTTTCGATTAC GGCCGTAACTACGGTGTGGTTTATGATGCACTGGGTTACACCGATATGCTGCCAGAATTT GGTGGTGATACTGCATACAGCGATGACTTCTTCGTTGGTCGTGTTGGCGGCGTTGCTACC TATCGTAACTCCAACTTCTTTGGTCTGGTTGATGGCCTGAACTTCGCTGTTCAGTACCTG GGTAAAAACGAGCGTGACACTGCACGCCGTTCTAACGGCGACGGTGTTGGCGGTTCTATC AGCTACGAATACGAAGGCTTTGGTATCGTTGGTGCTTATGGTGCAGCTGACCGTACCAAC CTGCAAGAAGCTCAACCTCTTGGCAACGGTAAAAAAGCTGAACAGTGGGCTACTGGTCTG AAGTACGACGCGAACAACATCTACCTGGCAGCGAACTACGGTGAAACCCGTAACGCTACG CCGATCACTAATAAATTTACAAACACCAGCGGCTTCGCCAACAAAACGCAAGACGTTCTG TTAGTTGCGCAATACCAGTTCGATTTCGGTCTGCGTCCGTCCATCGCTTACACCAAATCT AAAGCGAAAGACGTAGAAGGTATCGGTGATGTTGATCTGGTGAACTACTTTGAAGTGGGC GCAACCTACTACTTCAACAAAAACATGTCCACCTATGTTGACTACATCATCAACCAGATC GATTCTGACAACAAACTGGGCGTAGGTTCAGACGACACCGTTGCTGTGGGTATCGTTTAC CAGTTCTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P02931 UniProtKB Entry Name OMPF_ECOLI GenBank Protein ID 147010 GenBank Gene ID J01655 - General References
- Inokuchi K, Mutoh N, Matsuyama S, Mizushima S: Primary structure of the ompF gene that codes for a major outer membrane protein of Escherichia coli K-12. Nucleic Acids Res. 1982 Nov 11;10(21):6957-68. [Article]
- Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al.: A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map. DNA Res. 1996 Jun 30;3(3):137-55. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Mutoh N, Inokuchi K, Mizushima S: Amino acid sequence of the signal peptide of OmpF, a major outer membrane protein of Escherichia coli. FEBS Lett. 1982 Jan 25;137(2):171-4. [Article]
- Chen R, Kramer C, Schmidmayr W, Chen-Schmeisser U, Henning U: Primary structure of major outer-membrane protein I (ompF protein, porin) of Escherichia coli B/r. Biochem J. 1982 Apr 1;203(1):33-43. [Article]
- Nogami T, Mizuno T, Mizushima S: Construction of a series of ompF-ompC chimeric genes by in vivo homologous recombination in Escherichia coli and characterization of the translational products. J Bacteriol. 1985 Nov;164(2):797-801. [Article]
- Link AJ, Robison K, Church GM: Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12. Electrophoresis. 1997 Aug;18(8):1259-313. [Article]
- Molloy MP, Herbert BR, Walsh BJ, Tyler MI, Traini M, Sanchez JC, Hochstrasser DF, Williams KL, Gooley AA: Extraction of membrane proteins by differential solubilization for separation using two-dimensional gel electrophoresis. Electrophoresis. 1998 May;19(5):837-44. [Article]
- VanBogelen RA, Abshire KZ, Moldover B, Olson ER, Neidhardt FC: Escherichia coli proteome analysis using the gene-protein database. Electrophoresis. 1997 Aug;18(8):1243-51. [Article]
- Stenberg F, Chovanec P, Maslen SL, Robinson CV, Ilag LL, von Heijne G, Daley DO: Protein complexes of the Escherichia coli cell envelope. J Biol Chem. 2005 Oct 14;280(41):34409-19. Epub 2005 Aug 3. [Article]
- Duval V, Nicoloff H, Levy SB: Combined inactivation of lon and ycgE decreases multidrug susceptibility by reducing the amount of OmpF porin in Escherichia coli. Antimicrob Agents Chemother. 2009 Nov;53(11):4944-8. doi: 10.1128/AAC.00787-09. Epub 2009 Aug 31. [Article]
- Cowan SW, Schirmer T, Rummel G, Steiert M, Ghosh R, Pauptit RA, Jansonius JN, Rosenbusch JP: Crystal structures explain functional properties of two E. coli porins. Nature. 1992 Aug 27;358(6389):727-33. [Article]
- Jeanteur D, Schirmer T, Fourel D, Simonet V, Rummel G, Widmer C, Rosenbusch JP, Pattus F, Pages JM: Structural and functional alterations of a colicin-resistant mutant of OmpF porin from Escherichia coli. Proc Natl Acad Sci U S A. 1994 Oct 25;91(22):10675-9. [Article]
- Phale PS, Philippsen A, Kiefhaber T, Koebnik R, Phale VP, Schirmer T, Rosenbusch JP: Stability of trimeric OmpF porin: the contributions of the latching loop L2. Biochemistry. 1998 Nov 10;37(45):15663-70. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB04233 (Hydroxyethyloxy)Tri(Ethyloxy)Octane experimental unknown Details DB07084 N-(6,7,9,10,17,18,20,21-octahydrodibenzo[b,k][1,4,7,10,13,16]hexaoxacyclooctadecin-2-yl)acetamide experimental unknown Details DB13092 Meclocycline investigational no substrate Details DB01017 Minocycline approved, investigational unknown substrate Details