| Version |
2.5 |
| Creation Date |
2005-06-13 13:24:05 |
| Update Date |
2009-04-16 16:47:53 |
| Primary Accession Number |
DB00668 |
| Secondary Accession Number |
|
| Name |
Epinephrine |
| Drug Type |
|
| Description |
The active sympathomimetic hormone from the adrenal medulla in most species. It stimulates both the alpha- and beta- adrenergic systems, causes systemic vasoconstriction and gastrointestinal relaxation, stimulates the heart, and dilates bronchi and cerebral vessels. It is used in asthma and cardiac failure and to delay absorption of local anesthetics. [PubChem] |
| Synonyms |
- ADR Adrenaline
- Adrenalin
- Adrenalin Chloride
- Adrenalina
- Adrenaline
- Adrenalinum
- D-Adrenaline
- D-Epifrin
- D-Epinephrine
- Epinefrin [Czech]
- Epinefrina [INN-Spanish]
- Epinephran
- Epinephrine Bitartrate
- Epinephrinum [INN-Latin]
- L-Adrenalin
- L-Adrenaline
- L-Adrenaline Base
- L-Epinephine
- L-Epinephrine
- L-Epirenamine
- Levoadrenaline
- Levoepinephrine
- Racepinefrina [inn-spanish]
- Racepinefrine
- Racepinefrinum [inn-latin]
- Racepinephrine
|
| Brand Names |
- ADROP
- Adnephrine
- Adrenal
- Adrenalin-Medihaler
- Adrenamine
- Adrenan
- Adrenapax
- Adrenasol
- Adrenatrate
- Adrenine
- Adrenodis
- Adrenohorma
- Adrenor
- Adrenosan
- Adrenutol
- Adrin
- Adrine
- Aktamin
- Ana-Guard
- Antiasthmatique
- Asmatane Mist
- Asthma Meter Mist
- Asthma-Nefrin
- Asthmahaler Mist
- Asthmanefrin
- Astmahalin
- Astminhal
- Balmadren
- Bernarenin
- Biorenine
- Bosmin
- Brevirenin
- Bronkaid
- Bronkaid Mist
- Bronkaid Suspension Mist
- Chelafrin
- Citanest Forte
- Corisol
- Drenamist
- Duranest
- Dylephrin
- Epi EZ Pen Jr
- Epifrin
- Epiglaufrin
- Epipen
- Epipen Auto-Injector
- Epipen EZ Pen
- Epipen Jr.
- Epipen Jr. Auto-Injector
- Epirenamine
- Epirenan
- Epirenin
- Epitrate
- Eppy
- Esphygmogenina
- Exadrin
- Glaucon
- Glaucosan
- Glauposine
- Glycirenan
- Haemostasin
- Haemostatin
- Hektalin
- Hemisine
- Hemostasin
- Hemostatin
- Hypernephrin
- Hyporenin
- IOP
- Intranefrin
- Iontocaine
- Isoptoepinal
- Kidoline
- Levonor
- Levorenen
- Levorenin
- Levorenine
- Lidocaton
- Lyophrin
- Medihaler-Epi
- Metanephrin
- Micronefrin
- Mucidrina
- Myosthenine
- Mytrate
- Nephridine
- Nephron
- Nieraline
- Nor-Epirenan
- Norartrinal
- Paranephrin
- Primatene Mist
- Renagladin
- Renaglandin
- Renaglandulin
- Renaleptine
- Renalina
- Renoform
- Renostypricin
- Renostypticin
- Renostyptin
- Scurenaline
- Septocaine
- Simplene
- Sindrenina
- Soladren
- Sphygmogenin
- Stryptirenal
- Styptirenal
- Supracapsulin
- Supradin
- Supranefran
- Supranephrane
- Supranephrine
- Supranol
- Suprarenaline
- Suprarenin
- Suprel
- Surenine
- Surrenine
- Sus-Phrine
- Susphrine
- Sympathin E
- Sympathin I
- Takamina
- Takamine
- Tokamina
- Tolansin
- Tolax
- Tolcil
- Tolhart
- Tonogen
- Twinject
- Vaponefrin
- Vasoconstrictine
- Vasodrine
- Vasoton
- Vasotonin
|
| Brand Mixtures |
- 1% Lidocaine Hydrochloride and Epinephrine 1:100000 Inj Usp (Epinephrine + Lidocaine Hydrochloride)
- 2% Lidocaine Hydrochloride and Epinephrine 1:100000 Inj Usp (Epinephrine + Lidocaine Hydrochloride)
- 2% Xylocaine Dental with Epinephrine 1:100,000 (Epinephrine + Lidocaine Hydrochloride)
- 2% Xylocaine Dental with Epinephrine 1:50,000 (Epinephrine + Lidocaine Hydrochloride)
- 4% Citanest Forte Dental with Epinephrine 1:200,000 (Epinephrine (Epinephrine Bitartrate) + Prilocaine Hydrochloride)
- Ad Plex (Celandine + Echinacea Angustifolia + Epinephrine + Lycopodium Clavatum + Milk Thistle + Phosphoric Acid + Propolis + Sodium Chloride)
- Ad Tonic (Charcoal Activated + Epinephrine + Glycyrrhiza Glabra + Iodine + Lycopodium Clavatum + Oats + Phosphoric Acid + Potassium Phosphate Dibasic + Sarsaparilla + Sodium Chloride)
- Adaptagen (Capsicum + Charcoal Activated + Conium Maculatum + Copper + Elaeis Guineensis + Epinephrine + Ginkgo Biloba + Ginseng + Glycyrrhiza Glabra + Iodine + Ledum Palustre + Oats + Phosphoric Acid + Picric Acid + Pituitary Posterior + Selenium + Sepia Officinalis L + Silicon Dioxide + Sodium Carbonate (Anhydrous) + Thuja Occidentalis + Vitamin B1 + Vitamin B2)
- All- I (Charcoal Activated + Epinephrine + Histamine + Liverwort + Lycopodium Clavatum + Phosphorus + Potassium Phosphate Dibasic + Pulsatilla + Silicon Dioxide + Sodium Phosphate Dibasic)
- All-Ii (Epinephrine + Euphrasia Officinalis + Goldenrod + Histamine + Liverwort + Modified Ragweed Tyrosine Adsorbate + Phosphorus + Potassium Iodide + Pulsatilla + Sulfur)
- Allforce (Aralia Racemosa + Cantharides + Charcoal Activated + Epinephrine + Ginger + Glycyrrhiza Glabra + Iodine + Onion + Oyster Shells + Phosphorus + Poison Ivy + Sarsaparilla + Sodium Carbonate (Anhydrous))
- Alopt (Baptisia Tinctoria + Echinacea Angustifolia + Epinephrine + Euphrasia Officinalis + Garlic + Goldenrod + Histamine + Modified Ragweed Tyrosine Adsorbate + Onion + Phosphorus + Potassium Dichromate + Pulsatilla + Sulfur)
- Alphacaine Hcl 2% W Epineph 1:100000 (Epinephrine + Lidocaine Hydrochloride)
- Alphacaine Hcl 2% W Epineph 1:50000 (Epinephrine + Lidocaine Hydrochloride)
- Ana-Kit (2mg/Tab Orl, 1mg/Ml Liq Sc Im) (Chlorpheniramine Maleate + Epinephrine)
- Ana-Kit (Chlorpheniramine Maleate + Epinephrine Hcl)
- Anakit Insect Sting Treatment Kit (Chlorpheniramine Maleate + Epinephrine)
- Andropt (Astragalus Menziesii + Echinacea Angustifolia + Epinephrine + Juniper Berries + Oats + Phosphoric Acid + Picric Acid + Pulsatilla + Saw Palmetto + Selenium + Sodium Hexafluorosilicate + Thuja Occidentalis + Vitex Agnus Castus)
- Bac (Astragalus Menziesii + Baptisia Tinctoria + Belladonna + Charcoal Activated + Echinacea Angustifolia + Epinephrine + Ferrum Phosphoricum + Hydrastis Canadensis + Hypericum Perforatum + Iodine + Myrrh + Phosphorus + Phytolacca Decandra + Propolis + Silicon Dioxide + Water Cress)
- Candopt (Astragalus Menziesii + Echinacea Angustifolia + Epinephrine + Fucus Vesiculosus + Hydrastis Canadensis + Lycopodium Clavatum + Phosphoric Acid + Platanus Occidentalis + Pulsatilla + Sepia Officinalis L + Sodium Chloride)
- Chemtox (Barberry Root + Belladonna + Burdock + Cascarilla + Charcoal Activated + Couch Grass + Epinephrine + Glycerine + Glycyrrhiza Glabra + Iodine + Liverwort + Lycopodium Clavatum + Nitric Acid + Phosphoric Acid + Phosphorus + Phytolacca Decandra + Pulsatilla + Stillingia + Trifolium Pratense + Xanthoxylum)
- Crc-Plex (Arnica Montana + Barium Chloride + Calcium Lactate + Charcoal Activated + Cholesterol + Convallaria Majalis + Epinephrine + Iodine + Magnesium Carbonate + Nitroglycerin + Phosphorus + Picric Acid + Potassium Iodide + Strophanthus Hispidus)
- Cv Tox (Astragalus Menziesii + Barberry Root + Diadem Spider + Echinacea Angustifolia + Epinephrine + Gelsemium Sempervirens + Hydrastis Canadensis + Hydrochloric Acid + Ipecac + Lycopodium Clavatum + Nitric Acid + Phosphoric Acid + Poison Ivy + Scurvy Grass + Silicon Dioxide)
- E-Pilo 1 Ophthalmic Solution (Epinephrine Bitartrate + Pilocarpine Hydrochloride)
- E-Pilo 2 Ophthalmic Solution (Epinephrine Bitartrate + Pilocarpine Hydrochloride)
- E-Pilo 4 Ophthalmic Solution (Epinephrine Bitartrate + Pilocarpine Hydrochloride)
- E-Pilo 6 Ophthalmic Solution (Epinephrine Bitartrate + Pilocarpine Hydrochloride)
- E-Pilo-1 Oph Soln (Epinephrine Bitartrate + Pilocarpine Hydrochloride)
- E-Pilo-2 Oph Soln (Epinephrine Bitartrate + Pilocarpine Hydrochloride)
- E-Pilo-4 Oph Soln (Epinephrine Bitartrate + Pilocarpine Hydrochloride)
- E-Pilo-6 Oph Soln (Epinephrine Bitartrate + Pilocarpine Hydrochloride)
- Endangitin (Aesculus Hippocastanum + Cupric Acetate + Epinephrine + Ergot + Potentilla Anserina + Tobacco + White Hellebore Root)
- Endoplex F (Bovine Ovaries, Dried + Charcoal Activated + Cimicifuga Racemosa + Epinephrine + Fucus Vesiculosus + Glycyrrhiza Glabra + Iodine + Murex Purpurea + Pituitary Posterior + Pulsatilla + Sabina + Sepia Officinalis L + Xanthoxylum)
- Endoplex M (Clematis Erecta + Conium Maculatum + Epinephrine + Ginseng + Juniper Berries + Lycopodium Clavatum + Parsley + Picric Acid + Pituitary Posterior + Pulsatilla + Saw Palmetto + Thuja Occidentalis + Uva Ursi + Vitex Agnus Castus + Xanthoxylum)
- Ev Tox (Astragalus Menziesii + Belladonna + Charcoal Activated + Diadem Spider + Echinacea Angustifolia + Epinephrine + Hydrastis Canadensis + Hydrochloric Acid + Ipecac + Lycopodium Clavatum + Nitric Acid + Poison Ivy + Propolis + Scurvy Grass + Silicon Dioxide)
- F Alleropt (Aethusa Cynapium + Belladonna + Capsicum + Charcoal Activated + Comfrey + Echinacea Angustifolia + Epinephrine + Gentiana Cruciata + Histamine + Lycopodium Clavatum + Phosphorus + Potassium Dichromate + Pulsatilla)
- Fml-Tox (Angelicae Sinensis Radix + Beechwood Creosote + Boric Acid + Cimicifuga Racemosa + Epinephrine + Iodine + Oophorinum + Oyster Shells + Placenta + Pulsatilla + Sepia Officinalis L + Sodium Chloride + Sulfur + Zinc)
- Fng I (Astragalus Menziesii + Condurango + Echinacea Angustifolia + Epinephrine + Ginkgo Biloba + Hydrastis Canadensis + Lycopodium Clavatum + Phosphoric Acid + Phosphorus + Phytolacca Decandra + Propolis + Sepia Officinalis L + Sodium Chloride + Water Cress)
- Fng Ii (Astragalus Menziesii + Candida Parapsilosis + Charcoal Activated + Echinacea Angustifolia + Epinephrine + Hydrastis Canadensis + Iodine + Lycopodium Clavatum + Phosphoric Acid + Pulsatilla + Sepia Officinalis L + Silver + Sodium Chloride + Water Cress)
- Gingibraid W Alum Pot Sulf and Epin 0e (Aluminum Potassium Sulfate + Racemic Epinephrine Hydrochloride)
- Gingibraid W Epineph and Alum 1e (Aluminum Potassium Sulfate + Racemic Epinephrine Hydrochloride)
- Gingibraid W Epineph and Alum 2e (Aluminum Potassium Sulfate + Racemic Epinephrine Hydrochloride)
- Gingibraid W Epineph and Alum 3e (Aluminum Potassium Sulfate + Racemic Epinephrine Hydrochloride)
- Gingicord W Epineph and Alum Size No 1 (Aluminum Potassium Sulfate + Racemic Epinephrine Hydrochloride)
- Gingicord W Epineph and Alum Size No 3 (Aluminum Potassium Sulfate + Racemic Epinephrine Hydrochloride)
- Gingicord W/Epineph and Alum Size 2 (Aluminum Potassium Sulfate + Racemic Epinephrine Hydrochloride)
- Gynopt (Angelica + Beechwood Creosote + Boric Acid + Bovine Ovaries, Dried + Charcoal Activated + Cimicifuga Racemosa + Epinephrine + Iodine + Nitric Acid + Placenta + Potassium Acetate + Pulsatilla + Sepia Officinalis L + Sodium Chloride + Sulfur)
- Immplex (Astragalus Menziesii + Calcium Sulfide Crude + Echinacea Angustifolia + Epinephrine + Eupatorium Perfoliatum + Ferrum Phosphoricum + Hydrastis Canadensis + Myrrh + Phosphoric Acid + Propolis + Silicon Dioxide + Water Cress)
- Lido-2 Liq (Epinephrine Hcl + Lidocaine Hydrochloride)
- Lidocaine 2% Sterile Injectable Solution (Epinephrine Racemic + Lidocaine Hydrochloride)
- Lidocaine 2% with Epinephrine 1:100000 (Epinephrine + Lidocaine Hydrochloride)
- Lidocaine Hcl 2% (Epinephrine + Lidocaine Hydrochloride)
- Lidocaine Hcl 2% Epinephrine Inj (Epinephrine + Lidocaine Hydrochloride)
- Lidocaine Hcl 2% W Epineph 1:100000inj (Epinephrine + Lidocaine Hydrochloride)
- Lidocaine Hcl 2% W Epinephrine (Epinephrine + Lidocaine Hydrochloride)
- Lidocaine Hcl 2% W Epinephrine 1:100000 (Epinephrine + Lidocaine Hydrochloride)
- Lidocaine Hcl 2% W Epinephrine 1:50000 (Epinephrine + Lidocaine Hydrochloride)
- Lidocaine Inj 2% (Epinephrine Hcl + Lidocaine Hydrochloride)
- Lidocaine and Epinephrine Inj.Usp2% 1:100000 (Epinephrine + Lidocaine Hydrochloride)
- Lignospan Forte (Epinephrine + Lidocaine Hydrochloride)
- Lignospan Speciale Inj (Epinephrine + Lidocaine Hydrochloride)
- Lignospan Standard (Epinephrine + Lidocaine Hydrochloride)
- Marcaine E 0.25% Liq Prt (Bupivacaine Hydrochloride + Epinephrine Bitartrate)
- Marcaine E 2.5 Mg/Ml (Bupivacaine Hydrochloride + Epinephrine Bitartrate)
- Marcaine E 5.0 Mg/Ml (Bupivacaine Hydrochloride + Epinephrine Bitartrate)
- Marcaine E Liq Prt 0.50% (Bupivacaine Hydrochloride + Epinephrine Bitartrate)
- Nasal Spray (Echinacea Angustifolia + Epinephrine + Gelsemium Sempervirens + Modified Ragweed Tyrosine Adsorbate + Onion + Potassium Iodide + Sanguinaria Canadensis + Sticta Pulmonaria)
- Neuplex (Agaricus Muscarius + Arnica Montana + Charcoal Activated + Diadem Spider + Epinephrine + Hypericum Perforatum + Iodine + Passion Flower + Plumbum Metallicum + Trifolium Pratense)
- Octocaine 100 Needleject Inj (Epinephrine + Lidocaine Hydrochloride)
- Octocaine Hcl 2% Epinephrine 1:100000inj (Epinephrine Hcl + Lidocaine Hydrochloride)
- Octocaine Hcl 2% Epinephrine 1:50000inj (Epinephrine Hcl + Lidocaine Hydrochloride)
- Panplex (Celandine + Charcoal Activated + Common Bean Garden + Epinephrine + Eugenia Jambolana + Ginger + Glycyrrhiza Glabra + Hydrastis Canadensis + Iodine + Liverwort + Nux Moschata + Pancreas + Phosphoric Acid + Phosphorus + Pituitary Posterior + Rhubarb + Taraxacum Officinale Weber)
- Prilocaine Hcl 4% Epineph 1:200000inj (Epinephrine + Prilocaine Hydrochloride)
- R63 (Aesculus Hippocastanum + Cupric Acetate + Epinephrine + Potentilla Anserina + Tobacco)
- Racord Two 7 (Racemic Epinephrine Hydrochloride + Zinc Phenolsulphonate)
- Racord Two No 10 (Racemic Epinephrine Hydrochloride + Zinc Phenolsulphonate)
- Racord Two No 8 (Racemic Epinephrine Hydrochloride + Zinc Phenolsulphonate)
- Racord Two No 9 (Racemic Epinephrine Hydrochloride + Zinc Phenolsulphonate)
- Radopt (Brassica Napus + Cadmium Iodatum + Cadmium Sulphuricum + Capsicum + Charcoal Activated + Diadem Spider + Epinephrine + Fucus Vesiculosus + Goldenrod + Iodine + Ipecac + Iridium Metallicum + Phosphoric Acid + Phosphorus + Uranium Nitrate + X-Ray)
- Rdn-Tox (Cadmium Iodatum + Cadmium Sulphuricum + Capsicum + Cetraria Islandica + Charcoal Activated + Epinephrine + Fucus Vesiculosus + Hydrangea Arborescens + Iodine + Phosphoric Acid + Phosphorus + Pulsatilla + Strontium Carbonate + Uranium Nitrate + X-Ray)
- Scandonest 2% Special Inj (Epinephrine + Mepivacaine Hydrochloride)
- Sensorcaine 0.25% with Epinephrine (Bupivacaine Hydrochloride + Epinephrine (Epinephrine Bitartrate))
- Sensorcaine 0.5% with Epinephrine (Bupivacaine Hydrochloride + Epinephrine (Epinephrine Bitartrate))
- Sensorcaine Forte (Bupivacaine Hydrochloride + Epinephrine (Epinephrine Bitartrate))
- Septanest N (Articaine Hydrochloride + Epinephrine (Epinephrine Bitartrate))
- Septanest Sp (Articaine Hydrochloride + Epinephrine (Epinephrine Bitartrate))
- Sil Trax Plus No 10 (Racemic Epinephrine Hydrochloride + Zinc Phenolsulphonate)
- Sil Trax Plus No 8 (Racemic Epinephrine Hydrochloride + Zinc Phenolsulphonate)
- Sil Trax Plus No 9 (Racemic Epinephrine Hydrochloride + Zinc Phenolsulphonate)
- Siltrax Plus 7 (Racemic Epinephrine Hydrochloride + Zinc Phenolsulphonate)
- Spinal Anaesthesia Tray (Dextrose + Epinephrine + Iodine (Povidone-Iodine) + Lidocaine Hydrochloride + Tetracaine Hydrochloride)
- Spinal Anaesthesia Tray (Dextrose + Epinephrine + Lidocaine Hydrochloride + Povidone-Iodine + Tetracaine Hydrochloride)
- Spinal Anesthesia Tray (Dextrose + Ephedrine Sulfate + Epinephrine + Lidocaine Hydrochloride + Tetracaine Hydrochloride)
- Spinal Anesthesia Tray (Dextrose + Epinephrine + Lidocaine Hydrochloride + Tetracaine Hydrochloride)
- Super Sulpak R 44 (Aluminum Potassium Sulfate + Racemic Epinephrine Hydrochloride)
- Super Sulpak R 45 (Aluminum Potassium Sulfate + Racemic Epinephrine Hydrochloride)
- Super Sulpak R 46 (Aluminum Potassium Sulfate + Racemic Epinephrine Hydrochloride)
- Systopt (Barberry Root + Burdock + Calcium Sulfide Crude + Celandine + Charcoal Activated + Conium Maculatum + Diadem Spider + Epinephrine + Glycyrrhiza Glabra + Goldenrod + Hydrastis Canadensis + Lycopodium Clavatum + Tarentula Cubensis + Thuja Occidentalis + Trifolium Pratense)
- Systox (Barberry Root + Boldo + Burdock + Calcium Sulfide Crude + Celandine + Charcoal Activated + Conium Maculatum + Diadem Spider + Epinephrine + Hydrastis Canadensis + Lycopodium Clavatum + Sarsaparilla + Taraxacum Officinale Weber + Tarentula Cubensis + Thuja Occidentalis + Trifolium Pratense)
- Tyd-Plex (Charcoal Activated + Epinephrine + Ferrous Iodide + Fucus Vesiculosus + Iodine + Oyster Shells + Phosphoric Acid + Pituitary Posterior + Potassium Iodide + Spongia Tosta)
- Ultracaine D-S Forte Injection (Articaine Hydrochloride + Epinephrine)
- Ultracaine D-S Injection (Articaine Hydrochloride + Epinephrine)
- Ultracaine Ds Forte Inj (Articaine Hydrochloride + Epinephrine)
- Ultracaine Ds Inj (Articaine Hydrochloride + Epinephrine)
- Universaltox (Alfalfa + Buckthorn + Charcoal Activated + Coffea Tosta + Comfrey + Epinephrine + Fucus Vesiculosus + Iodine + Liverwort + Lycopodium Clavatum + Manganese + Oats + Oyster Shells + Poison Ivy + Pulsatilla + Sepia Officinalis L + Sodium Chloride + Spigelia Anthelmia + Water Cress)
- Vactox (Arnica Montana + Astragalus Menziesii + Baptisia Tinctoria + Belladonna + Calendula + Celandine + Echinacea Angustifolia + Epinephrine + Gelsemium Sempervirens + German Chamomile + Hydrastis Canadensis + Lycopodium Clavatum + Phytolacca Decandra + Poison Ivy + Propolis + Silicon Dioxide + Taraxacum Officinale Weber + Thuja Occidentalis + Trifolium Pratense + Urtica Urens + Water Cress)
- Virotox (Astragalus Menziesii + Belladonna + Echinacea Angustifolia + Epinephrine + Eupatorium Perfoliatum + Gelsemium Sempervirens + Hydrastis Canadensis + Lycopodium Clavatum + Myrrh + Phytolacca Decandra + Water Cress)
- Xylocaine 0.5% W Epinephrine 1:100000 (Epinephrine + Lidocaine Hydrochloride)
- Xylocaine 0.5% W Epinephrine 1:200000 (Epinephrine + Lidocaine Hydrochloride)
- Xylocaine 1% W Epinephrine 1:100000 (Epinephrine + Lidocaine Hydrochloride)
- Xylocaine 1% W Epinephrine 1:200000 (Epinephrine + Lidocaine Hydrochloride)
- Xylocaine 1.5% W Epinephrine 1:200000 (Epinephrine + Lidocaine Hydrochloride)
- Xylocaine 1.5% W Epinephrine 1:200000 Test Dose (Epinephrine + Lidocaine Hydrochloride)
- Xylocaine 2% W Epinephrine 1:100000 (Epinephrine + Lidocaine Hydrochloride)
- Xylocaine 2% W Epinephrine 1:200000 (Epinephrine + Lidocaine Hydrochloride)
- Xylocaine Mpf 1.5% with Epinephrine (Epinephrine + Lidocaine Hydrochloride)
- Zorcaine (Articaine Hydrochloride + Epinephrine (Epinephrine Bitartrate))
|
| Chemical IUPAC Name |
4-[(1R)-1-hydroxy-2-methylaminoethyl]benzene-1,2-diol |
| Chemical Formula |
C9H13NO3 |
| Chemical Structure |
 |
| CAS Registry Number |
51-43-4 |
| InChI Identifier |
InChI=1/C9H13NO3/c1-10-5-9(13)6-2-3-7(11)8(12)4-6/h2-4,9-13H,5H2,1H3/t9-/m0/s1 |
| InChI Key |
UCTWMZQNUQWSLP-VIFPVBQEBW |
| KEGG Drug |
D00095  |
| KEGG Compound |
C00788  |
| PubChem Compound |
5816  |
| PubChem Substance |
7847163  |
| ChEBI ID |
28918  |
| PharmGKB ID |
PA449470  |
| HET ID |
ALE  |
| GenBank ID |
Not Available |
| Drug ID Number [DIN] |
00710814  |
| RxList Link |
http://www.rxlist.com/cgi/generic/epi.htm  |
| PDRhealth Link |
Not Available |
| Wikipedia Link |
http://en.wikipedia.org/wiki/Epinephrine  |
| FDA Label |
|
| Material Safety Data Sheet (MSDS) |
|
| Synthesis Reference |
Stolz, Ber. 37, 4149; Payne, Ind. Chem. 37, 523 |
| Average Molecular Weight |
183.2044 |
| Monoisotopic Molecular Weight |
183.0895 |
| State |
Solid |
| Melting Point |
211.5 oC |
| Experimental Water Solubility |
0.18 mg/mL at 20 oC [YALKOWSKY,SH & DANNENFELSER,RM (1992)]
Source: PhysProp
|
| Predicted Water Solubility |
1.86e+01 mg/mL
Calculated using ALOGPS
|
| Experimental LogP/Hydrophobicity |
-1.37 [HANSCH,C & LEO,AJ (1985)]
Source: PhysProp
|
| Predicted LogP |
-0.81
Calculated using ALOGPS
|
| Experimental LogS |
Not Available |
| Predicted LogS |
-0.99
Calculated using ALOGPS
|
| Experimental Caco2 Permeability |
-6.02 [ADME Research, USCD] |
| pKa/Isoelectric Point |
8.59 |
| Mass Spectrum |
Not Available
|
| MOL File |
Show | Download  |
| SDF File |
Show | Download  |
| PDB File |
Show | Download  |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
3PAH  |
| Experimental PDB File |
Show |
| Experimental PDB Structure |
|
| Isomeric SMILES |
CNC[C@H](O)C1=CC(O)=C(O)C=C1 |
| Canonical SMILES |
CNCC(O)C1=CC(O)=C(O)C=C1 |
| Drug Category |
- Adrenergic Agonists
- Adrenergic alpha-Agonists
- Adrenergic beta-Agonists
- Bronchodilator Agents
- Mydriatics
- Sympathomimetics
- Vasoconstrictor Agents
|
| ATC Codes |
|
| AHFS Codes |
- 12:12.12
- 52:24.00
- 52:32.00
- 92:02.00*
|
| Indication |
Used to treat anaphylaxis and sepsis. |
| Pharmacology |
Epinephrine is indicated for intravenous injection in treatment of acute hypersensitivity, treatment of acute asthmatic attacks to relieve bronchospasm, and treatment and prophylaxis of cardiac arrest and attacks of transitory atrioventricular heart block with syncopal seizures (Stokes-Adams Syndrome). The actions of epinephrine resemble the effects of stimulation of adrenergic nerves. To a variable degree it acts on both alpha and beta receptor sites of sympathetic effector cells. Its most prominent actions are on the beta receptors of the heart, vascular and other smooth muscle. When given by rapid intravenous injection, it produces a rapid rise in blood pressure, mainly systolic, by (1) direct stimulation of cardiac muscle which increases the strength of ventricular contraction, (2) increasing the heart rate and (3) constriction of the arterioles in the skin, mucosa and splanchnic areas of the circulation. When given by slow intravenous injection, epinephrine usually produces only a moderate rise in systolic and a fall in diastolic pressure. Although some increase in pulse pressure occurs, there is usually no great elevation in mean blood pressure. Accordingly, the compensatory reflex mechanisms that come into play with a pronounced increase in blood pressure do not antagonize the direct cardiac actions of epinephrine as much as with catecholamines that have a predominant action on alpha receptors. |
| Mechanism of Action |
Epinephrine works via the stimulation of alpha and beta-1 adrenergic receptors, and a moderate activity at beta-2 adrenergic receptors. |
| Absorption |
Usually this vasodilator effect of the drug on the circulation predominates so that the modest rise in systolic pressure which follows slow injection or absorption is mainly the result of direct cardiac stimulation and increase in cardiac output. |
| Toxicity |
Skin, LD50 = 62 mg/kg (rat) |
| Protein Binding |
Not Available |
| Biotransformation |
Epinephrine is rapidly inactivated in the body and is degraded by enzymes in the liver and other tissues. The larger portion of injected doses is excreted in the urine as inactivated compounds and the remainder either partly unchanged or conjugated. The drug becomes fixed in the tissues and is inactivated chiefly by enzymatic transformation to metanephrine or normetanephrine either of which is subsequently conjugated and excreted in the urine in the form of sulfates and glucuronides. Either sequence results in the formation of 3-methoxy-4-hydroxy-mandelic acid which also is detectable in the urine. |
| Half Life |
2 minutes |
| Dosage Forms |
| Form |
Route |
| Liquid |
Intramuscular |
| Liquid |
Oral |
| Solution |
Intramuscular |
| Solution |
Intravenous |
| Solution |
Nasal |
| Solution |
Respiratory (inhalation) |
| Solution / drops |
Ophthalmic |
| Solution / drops |
Oral |
|
| Patient Information |
Not Available |
| Contraindications |
Show  |
| Interactions |
Show  |
| Drug Interactions |
| Drug |
Interaction |
| Acebutolol |
Hypertension, then bradycardia |
| Alseroxylon |
Increased arterial pressure |
| Amitriptyline |
The tricyclic increases the sympathomimetic effect |
| Amoxapine |
The tricyclic increases the sympathomimetic effect |
| Atenolol |
Hypertension, then bradycardia |
| Betaxolol |
Hypertension, then bradycardia |
| Bevantolol |
Hypertension, then bradycardia |
| Bisoprolol |
Hypertension, then bradycardia |
| Carteolol |
Hypertension, then bradycardia |
| Carvedilol |
Hypertension, then bradycardia |
| Clomipramine |
The tricyclic increases the sympathomimetic effect |
| Deserpidine |
Increased arterial pressure |
| Desipramine |
The tricyclic increases the sympathomimetic effect |
| Doxepin |
The tricyclic increases the sympathomimetic effect |
| Entacapone |
Entacapone increases the effect and toxicity of sympathomimetics |
| Ergonovine |
Possible marked increase of arterial pressure |
| Esmolol |
Hypertension, then bradycardia |
| Guanethidine |
The agent decreases the effect of guanethidine |
| Imipramine |
The tricyclic increases the sympathomimetic effect |
| Isocarboxazid |
Increased arterial pressure |
| Labetalol |
Hypertension, then bradycardia |
| Linezolid |
Possible increase of arterial pressure |
| Methyldopa |
Increased arterial pressure |
| Methylergonovine |
Possible marked increase of arterial pressure |
| Metoprolol |
Hypertension, then bradycardia |
| Midodrine |
Increased arterial pressure |
| Moclobemide |
Moclobemide increases the sympathomimetic effect |
| Nadolol |
Hypertension, then bradycardia |
| Nortriptyline |
The tricyclic increases the sympathomimetic effect |
| Oxprenolol |
Hypertension, then bradycardia |
| Oxytocin |
Possible marked increase of arterial pressure |
| Pargyline |
Increased arterial pressure |
| Penbutolol |
Hypertension, then bradycardia |
| Phenelzine |
Increased arterial pressure |
| Pindolol |
Hypertension, then bradycardia |
| Practolol |
Hypertension, then bradycardia |
| Propranolol |
Hypertension, then bradycardia |
| Protriptyline |
The tricyclic increases the sympathomimetic effect |
| Rasagiline |
Increased arterial pressure |
| Reserpine |
Increased arterial pressure |
| Sotalol |
Hypertension, then bradycardia |
| Timolol |
Hypertension, then bradycardia |
| Tranylcypromine |
Increased arterial pressure |
| Trimipramine |
The tricyclic increases the sympathomimetic effect |
|
| Food Interactions |
Not Available
|
| Pathways |
Not Available
|
| General References |
- Bennett MR: One hundred years of adrenaline: the discovery of autoreceptors. Clin Auton Res. 1999 Jun;9(3):145-59. [PubMed
]
- Yamashima T: Jokichi Takamine (1854-1922), the samurai chemist, and his work on adrenalin. J Med Biogr. 2003 May;11(2):95-102. [PubMed
]
- Drugs.com

- Wikipedia

- RxList

|
| Organisms Affected |
|
| Targets |
- Beta-1 adrenergic receptor
- Alpha-1A adrenergic receptor
- Beta-2 adrenergic receptor
- Phenylalanine-4-hydroxylase
|
|
Drug Target 1
[top]
|
| Target 1 ID |
193 |
| Target 1 Name |
Beta-1 adrenergic receptor |
| Target 1 Synonyms |
- Beta-1 adrenoceptor
- Beta-1 adrenoreceptor
|
| Target 1 Gene Name |
ADRB1 |
| Target 1 Protein Sequence |
>Beta-1 adrenergic receptor
MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAG
MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPVPAPAPPPGPPRPAAAAATAP
LANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFV
FFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGP
PPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
|
| Target 1 Number of Residues |
484 |
| Target 1 Molecular Weight |
51323 |
| Target 1 Theoretical pI |
9.03 |
| Target 1 GO Classification |
|
Function
|
signal transducer activity
receptor activity
transmembrane receptor activity
G-protein coupled receptor activity
rhodopsin-like receptor activity
amine receptor activity
adrenoceptor activity
beta-adrenergic receptor activity
beta1-adrenergic receptor activity |
|
Process
|
cellular process
cell communication
signal transduction
cell surface receptor linked signal transduction
G-protein coupled receptor protein signaling pathway |
|
Component
|
cell
membrane
intrinsic to membrane
integral to membrane |
|
| Target 1 General Function |
Involved in beta1-adrenergic receptor activity |
| Target 1 Specific Function |
Beta-adrenergic receptors mediate the catecholamine- induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity |
| Target 1 Pathways |
Not Available
|
| Target 1 Reactions |
Not Available |
| Target 1 Pfam Domain Function |
|
| Target 1 Signals |
|
| Target 1 Transmembrane Regions |
- 60-83
- 97-120
- 132-155
- 176-199
- 222-245
- 326-349
- 357-380
|
| Target 1 Essentiality |
Non-Essential |
| Target 1 GenBank ID Protein |
178200  |
| Target 1 UniProtKB/Swiss-Prot ID |
P08588  |
| Target 1 UniProtKB/Swiss-Prot Entry Name |
ADRB1_HUMAN  |
| Target 1 PDB ID |
Not Available |
| Target 1 Cellular Location |
- Cell membrane
- multi-pass membrane protein. Localized at the plasma membrane. Found in the Golgi upo
|
| Target 1 Gene Sequence |
>1434 bp
ATGGGCGCGGGGGTGCTCGTCCTGGGCGCCTCCGAGCCCGGTAACCTGTCGTCGGCCGCA
CCGCTCCCCGACGGCGCGGCCACCGCGGCGCGGCTGCTGGTGCCCGCGTCGCCGCCCGCC
TCGTTGCTGCCTCCCGCCAGCGAAAGCCCCGAGCCGCTGTCTCAGCAGTGGACAGCGGGC
ATGGGTCTGCTGATGGCGCTCATCGTGCTGCTCATCGTGGCGGGCAATGTGCTGGTGATC
GTGGCCATCGCCAAGACGCCGCGGCTGCAGACGCTCACCAACCTCTTCATCATGTCCCTG
GCCAGCGCCGACCTGGTCATGGGGCTGCTGGTGGTGCCGTTCGGGGCCACCATCGTGGTG
TGGGGCCGCTGGGAGTACGGCTCCTTCTTCTGCGAGCTGTGGACCTCAGTGGACGTGCTG
TGCGTGACGGCCAGCATCGAGACCCTGTGTGTCATTGCCCTGGACCGCTACCTCGCCATC
ACCTCGCCCTTCCGCTACCAGAGCCTGCTGACGCGCGCGCGGGCGCGGGGCCTCGTGTGC
ACCGTGTGGGCCATCTCGGCCCTGGTGTCCTTCCTGCCCATCCTCATGCACTGGTGGCGG
GCGGAGAGCGACGAGGCGCGCCGCTGCTACAACGACCCCAAGTGCTGCGACTTCGTCACC
AACCGGGCCTACGCCATCGCCTCGTCCGTAGTCTCCTTCTACGTGCCCCTGTGCATCATG
GCCTTCGTGTACCTGCGGGTGTTCCGCGAGGCCCAGAAGCAGGTGAAGAAGATCGACAGC
TGCGAGCGCCGTTTCCTCGGCGGCCCAGCGCGGCCGCCCTCGCCCTCGCCCTCGCCCGTC
CCCGCGCCCGCGCCGCCGCCCGGACCCCCGCGCCCCGCCGCCGCCGCCGCCACCGCCCCG
CTGGCCAACGGGCGTGCGGGTAAGCGGCGGCCCTCGCGCCTCGTGGCCCTACGCGAGCAG
AAGGCGCTCAAGACGCTGGGCATCATCATGGGCGTCTTCACGCTCTGCTGGCTGCCCTTC
TTCCTGGCCAACGTGGTGAAGGCCTTCCACCGCGAGCTGGTGCCCGACCGCCTCTTCGTC
TTCTTCAACTGGCTGGGCTACGCCAACTCGGCCTTCAACCCCATCATCTACTGCCGCAGC
CCCGACTTCCGCAAGGCCTTCCAGGGACTGCTCTGCTGCGCGCGCAGGGCTGCCCGCCGG
CGCCACGCGACCCACGGAGACCGGCCGCGCGCCTCGGGCTGTCTGGCCCGGCCCGGACCC
CCGCCATCGCCCGGGGCCGCCTCGGACGACGACGACGACGATGTCGTCGGGGCCACGCCG
CCCGCGCGCCTGCTGGAGCCCTGGGCCGGCTGCAACGGCGGGGCGGCGGCGGACAGCGAC
TCGAGCCTGGACGAGCCGTGCCGCCCCGGCTTCGCCTCGGAATCCAAGGTGTAG
|
| Target 1 GenBank Gene ID |
|
| Target 1 GeneCard ID |
ADRB1  |
| Target 1 GenAtlas ID |
ADRB1  |
| Target 1 HGNC ID |
HGNC:285  |
| Target 1 Chromosome Location |
10 |
| Target 1 Locus |
10q24-q26 |
| Target 1 SNPs |
SNPJam Report  |
| Target 1 General References |
- Mason DA, Moore JD, Green SA, Liggett SB: A gain-of-function polymorphism in a G-protein coupling domain of the human beta1-adrenergic receptor. J Biol Chem. 1999 Apr 30;274(18):12670-4. [PubMed
]
- Moore JD, Mason DA, Green SA, Hsu J, Liggett SB: Racial differences in the frequencies of cardiac beta(1)-adrenergic receptor polymorphisms: analysis of c145A>G and c1165G>C. Hum Mutat. 1999 Sep 19;14(3):271. [PubMed
]
- Borjesson M, Magnusson Y, Hjalmarson A, Andersson B: A novel polymorphism in the gene coding for the beta(1)-adrenergic receptor associated with survival in patients with heart failure. Eur Heart J. 2000 Nov;21(22):1853-8. [PubMed
]
- Ranade K, Jorgenson E, Sheu WH, Pei D, Hsiung CA, Chiang FT, Chen YD, Pratt R, Olshen RA, Curb D, Cox DR, Botstein D, Risch N: A polymorphism in the beta1 adrenergic receptor is associated with resting heart rate. Am J Hum Genet. 2002 Apr;70(4):935-42. Epub 2002 Feb 18. [PubMed
]
- Frielle T, Collins S, Daniel KW, Caron MG, Lefkowitz RJ, Kobilka BK: Cloning of the cDNA for the human beta 1-adrenergic receptor. Proc Natl Acad Sci U S A. 1987 Nov;84(22):7920-4. [PubMed
]
|
| Target 1 Drug References |
- Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed
]
- Leineweber K, Bogedain P, Wolf C, Wagner S, Weber M, Jakob HG, Heusch G, Philipp T, Brodde OE: In patients chronically treated with metoprolol, the demand of inotropic catecholamine support after coronary artery bypass grafting is determined by the Arg389Gly-beta 1-adrenoceptor polymorphism. Naunyn Schmiedebergs Arch Pharmacol. 2007 Jul;375(5):303-9. Epub 2007 Jun 1. [PubMed
]
- Ozakca I, Arioglu E, Guner S, Altan VM, Ozcelikay AT: Role of Beta-3-Adrenoceptor in Catecholamine-Induced Relaxations in Gastric Fundus from Control and Diabetic Rats. Pharmacology. 2007 Jul 6;80(4):227-238. [PubMed
]
|
|
Drug Target 2
[top]
|
| Target 2 ID |
556 |
| Target 2 Name |
Alpha-1A adrenergic receptor |
| Target 2 Synonyms |
- Alpha 1A- adrenoreceptor
- Alpha 1A-adrenoceptor
- Alpha adrenergic receptor 1c
- Alpha-1C adrenergic receptor
|
| Target 2 Gene Name |
ADRA1A |
| Target 2 Protein Sequence |
>Alpha-1A adrenergic receptor
MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
APAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTL
HPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
TARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV
|
| Target 2 Number of Residues |
473 |
| Target 2 Molecular Weight |
51487 |
| Target 2 Theoretical pI |
9.23 |
| Target 2 GO Classification |
|
Function
|
signal transducer activity
receptor activity
transmembrane receptor activity
G-protein coupled receptor activity
rhodopsin-like receptor activity
amine receptor activity
adrenoceptor activity
alpha-adrenergic receptor activity
alpha1-adrenergic receptor activity |
|
Process
|
cellular process
cell communication
signal transduction
cell surface receptor linked signal transduction
G-protein coupled receptor protein signaling pathway |
|
Component
|
cell
membrane
intrinsic to membrane
integral to membrane |
|
| Target 2 General Function |
Involved in alpha1-adrenergic receptor activity |
| Target 2 Specific Function |
This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol- calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins |
| Target 2 Pathways |
Not Available
|
| Target 2 Reactions |
Not Available |
| Target 2 Pfam Domain Function |
|
| Target 2 Signals |
|
| Target 2 Transmembrane Regions |
- 28-51
- 65-88
- 100-122
- 144-167
- 182-205
- 274-297
- 306-329
|
| Target 2 Essentiality |
Non-Essential |
| Target 2 GenBank ID Protein |
433201  |
| Target 2 UniProtKB/Swiss-Prot ID |
P35348  |
| Target 2 UniProtKB/Swiss-Prot Entry Name |
ADA1A_HUMAN  |
| Target 2 PDB ID |
Not Available |
| Target 2 Cellular Location |
- Membrane
- multi-pass membrane protein
|
| Target 2 Gene Sequence |
>1401 bp
ATGGTGTTTCTCTCGGGAAATGCTTCCGACAGCTCCAACTGCACCCAACCGCCGGCACCG
GTGAACATTTCCAAGGCCATTCTGCTCGGGGTGATCTTGGGGGGCCTCATTCTTTTCGGG
GTGCTGGGTAACATCCTAGTGATCCTCTCCGTAGCCTGTCACCGACACCTGCACTCAGTC
ACGCACTACTACATCGTCAACCTGGCGGTGGCCGACCTCCTGCTCACCTCCACGGTGCTG
CCCTTCTCCGCCATCTTCGAGGTCCTAGGCTACTGGGCCTTCGGCAGGGTCTTCTGCAAC
ATCTGGGCGGCAGTGGATGTGCTGTGCTGCACCGCGTCCATCATGGGCCTCTGCATCATC
TCCATCGACCGCTACATCGGCGTGAGCTACCCGCTGCGCTACCCAACCATCGTCACCCAG
AGGAGGGGTCTCATGGCTCTGCTCTGCGTCTGGGCACTCTCCCTGGTCATATCCATTGGA
CCCCTGTTCGGCTGGAGGCAGCCGGCCCCCGAGGACGAGACCATCTGCCAGATCAACGAG
GAGCCGGGCTACGTGCTCTTCTCAGCGCTGGGCTCCTTCTACCTGCCTCTGGCCATCATC
CTGGTCATGTACTGCCGCGTCTACGTGGTGGCCAAGAGGGAGAGCCGGGGCCTCAAGTCT
GGCCTCAAGACCGACAAGTCGGACTCGGAGCAAGTGACGCTCCGCATCCATCGGAAAAAC
GCCCCGGCAGGAGGCAGCGGGATGGCCAGCGCCAAGACCAAGACGCACTTCTCAGTGAGG
CTCCTCAAGTTCTCCCGGGAGAAGAAAGCGGCCAAAACGCTGGGCATCGTGGTCGGCTGC
TTCGTCCTCTGCTGGCTGCCTTTTTTCTTAGTCATGCCCATTGGGTCTTTCTTCCCTGAT
TTCAAGCCCTCTGAAACAGTTTTTAAAATAGTATTTTGGCTCGGATATCTAAACAGCTGC
ATCAACCCCATCATATACCCATGCTCCAGCCAAGAGTTCAAAAAGGCCTTTCAGAATGTC
TTGAGAATCCAGTGTCTCCGCAGAAAGCAGTCTTCCAAACATGCCCTGGGCTACACCCTG
CACCCGCCCAGCCAGGCCGTGGAAGGGCAACACAAGGACATGGTGCGCATCCCCGTGGGA
TCAAGAGAGACCTTCTACAGGATCTCCAAGACGGATGGCGTTTGTGAATGGAAATTTTTC
TCTTCCATGCCCCGTGGATCTGCCAGGATTACAGTGTCCAAAGACCAATCCTCCTGTACC
ACAGCCCGGGTGAGAAGTAAAAGCTTTTTGGAGGTCTGCTGCTGTGTAGGGCCCTCAACC
CCCAGCCTTGACAAGAACCATCAAGTTCCAACCATTAAGGTCCACACCATCTCCCTCAGT
GAGAACGGGGAGGAAGTCTAG
|
| Target 2 GenBank Gene ID |
|
| Target 2 GeneCard ID |
ADRA1A  |
| Target 2 GenAtlas ID |
ADRA1A  |
| Target 2 HGNC ID |
HGNC:277  |
| Target 2 Chromosome Location |
8 |
| Target 2 Locus |
8p21-p11.2 |
| Target 2 SNPs |
SNPJam Report  |
| Target 2 General References |
- Hirasawa A, Shibata K, Horie K, Takei Y, Obika K, Tanaka T, Muramoto N, Takagaki K, Yano J, Tsujimoto G: Cloning, functional expression and tissue distribution of human alpha 1c-adrenoceptor splice variants. FEBS Lett. 1995 Apr 24;363(3):256-60. [PubMed
]
- Schwinn DA, Johnston GI, Page SO, Mosley MJ, Wilson KH, Worman NP, Campbell S, Fidock MD, Furness LM, Parry-Smith DJ, et al.: Cloning and pharmacological characterization of human alpha-1 adrenergic receptors: sequence corrections and direct comparison with other species homologues. J Pharmacol Exp Ther. 1995 Jan;272(1):134-42. [PubMed
]
- Weinberg DH, Trivedi P, Tan CP, Mitra S, Perkins-Barrow A, Borkowski D, Strader CD, Bayne M: Cloning, expression and characterization of human alpha adrenergic receptors alpha 1a, alpha 1b and alpha 1c. Biochem Biophys Res Commun. 1994 Jun 30;201(3):1296-304. [PubMed
]
- Forray C, Bard JA, Wetzel JM, Chiu G, Shapiro E, Tang R, Lepor H, Hartig PR, Weinshank RL, Branchek TA, et al.: The alpha 1-adrenergic receptor that mediates smooth muscle contraction in human prostate has the pharmacological properties of the cloned human alpha 1c subtype. Mol Pharmacol. 1994 Apr;45(4):703-8. [PubMed
]
- Hirasawa A, Horie K, Tanaka T, Takagaki K, Murai M, Yano J, Tsujimoto G: Cloning, functional expression and tissue distribution of human cDNA for the alpha 1C-adrenergic receptor. Biochem Biophys Res Commun. 1993 Sep 15;195(2):902-9. [PubMed
]
- Tseng-Crank J, Kost T, Goetz A, Hazum S, Roberson KM, Haizlip J, Godinot N, Robertson CN, Saussy D: The alpha 1C-adrenoceptor in human prostate: cloning, functional expression, and localization to specific prostatic cell types. Br J Pharmacol. 1995 Aug;115(8):1475-85. [PubMed
]
- Chang DJ, Chang TK, Yamanishi SS, Salazar FH, Kosaka AH, Khare R, Bhakta S, Jasper JR, Shieh IS, Lesnick JD, Ford AP, Daniels DV, Eglen RM, Clarke DE, Bach C, Chan HW: Molecular cloning, genomic characterization and expression of novel human alpha1A-adrenoceptor isoforms. FEBS Lett. 1998 Jan 30;422(2):279-83. [PubMed
]
|
| Target 2 Drug References |
- Sanbe A, Tanaka Y, Fujiwara Y, Tsumura H, Yamauchi J, Cotecchia S, Koike K, Tsujimoto G, Tanoue A: alpha(1)-Adrenoceptors are required for normal male sexual function. Br J Pharmacol. 2007 Oct;152(3):332-40. Epub 2007 Jul 2. [PubMed
]
- Tomiyama Y, Kobayashi K, Tadachi M, Kobayashi S, Inada Y, Kobayashi M, Yamazaki Y: Expressions and mechanical functions of alpha(1)-adrenoceptor subtypes in hamster ureter. Eur J Pharmacol. 2007 Nov 14;573(1-3):201-5. Epub 2007 Jul 6. [PubMed
]
|
|
Drug Target 3
[top]
|
| Target 3 ID |
766 |
| Target 3 Name |
Beta-2 adrenergic receptor |
| Target 3 Synonyms |
- Beta-2 adrenoceptor
- Beta-2 adrenoreceptor
|
| Target 3 Gene Name |
ADRB2 |
| Target 3 Protein Sequence |
>Beta-2 adrenergic receptor
MGQPGNGSAFLLAPNRSHAPDHDVTQQRDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAK
FERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTAS
IETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQE
AINCYANETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRF
HVQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD
NLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGYSSNGNT
GEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLL
|
| Target 3 Number of Residues |
419 |
| Target 3 Molecular Weight |
46557 |
| Target 3 Theoretical pI |
7.44 |
| Target 3 GO Classification |
|
Function
|
signal transducer activity
receptor activity
transmembrane receptor activity
G-protein coupled receptor activity
rhodopsin-like receptor activity
amine receptor activity
adrenoceptor activity
beta-adrenergic receptor activity
beta2-adrenergic receptor activity |
|
Process
|
cellular process
cell communication
signal transduction
cell surface receptor linked signal transduction
G-protein coupled receptor protein signaling pathway |
|
Component
|
cell
membrane
intrinsic to membrane
integral to membrane |
|
| Target 3 General Function |
Involved in beta2-adrenergic receptor activity |
| Target 3 Specific Function |
Beta-adrenergic receptors mediate the catecholamine- induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine |
| Target 3 Pathways |
Not Available
|
| Target 3 Reactions |
Not Available |
| Target 3 Pfam Domain Function |
|
| Target 3 Signals |
|
| Target 3 Transmembrane Regions |
- 35-58
- 72-95
- 107-129
- 151-174
- 197-220
- 275-298
- 306-329
|
| Target 3 Essentiality |
Non-Essential |
| Target 3 GenBank ID Protein |
29371  |
| Target 3 UniProtKB/Swiss-Prot ID |
P07550  |
| Target 3 UniProtKB/Swiss-Prot Entry Name |
ADRB2_HUMAN  |
| Target 3 PDB ID |
Not Available |
| Target 3 Cellular Location |
- Membrane
- multi-pass membrane protein
|
| Target 3 Gene Sequence |
>1242 bp
ATGGGGCAACCCGGGAACGGCAGCGCCTTCTTGCTGGCACCCAATAGAAGCCATGCGCCG
GACCACGACGTCACGCAGCAAAGGGACGAGGTGTGGGTGGTGGGCATGGGCATCGTCATG
TCTCTCATCGTCCTGGCCATCGTGTTTGGCAATGTGCTGGTCATCACAGCCATTGCCAAG
TTCGAGCGTCTGCAGACGGTCACCAACTACTTCATCACTTCACTGGCCTGTGCTGATCTG
GTCATGGGCCTGGCAGTGGTGCCCTTTGGGGCCGCCCATATTCTTATGAAAATGTGGACT
TTTGGCAACTTCTGGTGCGAGTTTTGGACTTCCATTGATGTGCTGTGCGTCACGGCCAGC
ATTGAGACCCTGTGCGTGATCGCAGTGGATCGCTACTTTGCCATTACTTCACCTTTCAAG
TACCAGAGCCTGCTGACCAAGAATAAGGCCCGGGTGATCATTCTGATGGTGTGGATTGTG
TCAGGCCTTACCTCCTTCTTGCCCATTCAGATGCACTGGTACCGGGCCACCCACCAGGAA
GCCATCAACTGCTATGCCAATGAGACCTGCTGTGACTTCTTCACGAACCAAGCCTATGCC
ATTGCCTCTTCCATCGTGTCCTTCTACGTTCCCCTGGTGATCATGGTCTTCGTCTACTCC
AGGGTCTTTCAGGAGGCCAAAAGGCAGCTCCAGAAGATTGACAAATCTGAGGGCCGCTTC
CATGTCCAGAACCTTAGCCAGGTGGAGCAGGATGGGCGGACGGGGCATGGACTCCGCAGA
TCTTCCAAGTTCTGCTTGAAGGAGCACAAAGCCCTCAAGACGTTAGGCATCATCATGGGC
ACTTTCACCCTCTGCTGGCTGCCCTTCTTCATCGTTAACATTGTGCATGTGATCCAGGAT
AACCTCATCCGTAAGGAAGTTTACATCCTCCTAAATTGGATAGGCTATGTCAATTCTGGT
TTCAATCCCCTTATCTACTGCCGGAGCCCAGATTTCAGGATTGCCTTCCAGGAGCTTCTG
TGCCTGCGCAGGTCTTCTTTGAAGGCCTATGGGAATGGCTACTCCAGCAACGGCAACACA
GGGGAGCAGAGTGGATATCACGTGGAACAGGAGAAAGAAAATAAACTGCTGTGTGAAGAC
CTCCCAGGCACGGAAGACTTTGTGGGCCATCAAGGTACTGTGCCTAGCGATAACATTGAT
TCACAAGGGAGGAATTGTAGTACAAATGACTCACTGCTGTAA
|
| Target 3 GenBank Gene ID |
|
| Target 3 GeneCard ID |
ADRB2  |
| Target 3 GenAtlas ID |
ADRB2  |
| Target 3 HGNC ID |
HGNC:286  |
| Target 3 Chromosome Location |
5 |
| Target 3 Locus |
5q31-q32 |
| Target 3 SNPs |
SNPJam Report  |
| Target 3 General References |
- Cao TT, Deacon HW, Reczek D, Bretscher A, von Zastrow M: A kinase-regulated PDZ-domain interaction controls endocytic sorting of the beta2-adrenergic receptor. Nature. 1999 Sep 16;401(6750):286-90. [PubMed
]
- Moffett S, Rousseau G, Lagace M, Bouvier M: The palmitoylation state of the beta(2)-adrenergic receptor regulates the synergistic action of cyclic AMP-dependent protein kinase and beta-adrenergic receptor kinase involved in its phosphorylation and desensitization. J Neurochem. 2001 Jan;76(1):269-79. [PubMed
]
- O'Dowd BF, Hnatowich M, Caron MG, Lefkowitz RJ, Bouvier M: Palmitoylation of the human beta 2-adrenergic receptor. Mutation of Cys341 in the carboxyl tail leads to an uncoupled nonpalmitoylated form of the receptor. J Biol Chem. 1989 May 5;264(13):7564-9. [PubMed
]
- Emorine LJ, Marullo S, Delavier-Klutchko C, Kaveri SV, Durieu-Trautmann O, Strosberg AD: Structure of the gene for human beta 2-adrenergic receptor: expression and promoter characterization. Proc Natl Acad Sci U S A. 1987 Oct;84(20):6995-9. [PubMed
]
- Chung FZ, Wang CD, Potter PC, Venter JC, Fraser CM: Site-directed mutagenesis and continuous expression of human beta-adrenergic receptors. Identification of a conserved aspartate residue involved in agonist binding and receptor activation. J Biol Chem. 1988 Mar 25;263(9):4052-5. [PubMed
]
- Kobilka BK, Dixon RA, Frielle T, Dohlman HG, Bolanowski MA, Sigal IS, Yang-Feng TL, Francke U, Caron MG, Lefkowitz RJ: cDNA for the human beta 2-adrenergic receptor: a protein with multiple membrane-spanning domains and encoded by a gene whose chromosomal location is shared with that of the receptor for platelet-derived growth factor. Proc Natl Acad Sci U S A. 1987 Jan;84(1):46-50. [PubMed
]
- Chung FZ, Lentes KU, Gocayne J, Fitzgerald M, Robinson D, Kerlavage AR, Fraser CM, Venter JC: Cloning and sequence analysis of the human brain beta-adrenergic receptor. Evolutionary relationship to rodent and avian beta-receptors and porcine muscarinic receptors. FEBS Lett. 1987 Jan 26;211(2):200-6. [PubMed
]
- Schofield PR, Rhee LM, Peralta EG: Primary structure of the human beta-adrenergic receptor gene. Nucleic Acids Res. 1987 Apr 24;15(8):3636. [PubMed
]
- Kobilka BK, Frielle T, Dohlman HG, Bolanowski MA, Dixon RA, Keller P, Caron MG, Lefkowitz RJ: Delineation of the intronless nature of the genes for the human and hamster beta 2-adrenergic receptor and their putative promoter regions. J Biol Chem. 1987 May 25;262(15):7321-7. [PubMed
]
- Turki J, Pak J, Green SA, Martin RJ, Liggett SB: Genetic polymorphisms of the beta 2-adrenergic receptor in nocturnal and nonnocturnal asthma. Evidence that Gly16 correlates with the nocturnal phenotype. J Clin Invest. 1995 Apr;95(4):1635-41. [PubMed
]
- 7915137 Green SA, Turki J, Innis M, Liggett SB: Amino-terminal polymorphisms of the human beta 2-adrenergic receptor impart distinct agonist-promoted regulatory properties. Biochemistry. 1994 Aug 16;33(32):9414-9.
- 8383511 Reihsaus E, Innis M, MacIntyre N, Liggett SB: Mutations in the gene encoding for the beta 2-adrenergic receptor in normal and asthmatic subjects. Am J Respir Cell Mol Biol. 1993 Mar;8(3):334-9.
|
| Target 3 Drug References |
- Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed
]
- Prenner L, Sieben A, Zeller K, Weiser D, Haberlein H: Reduction of high-affinity beta2-adrenergic receptor binding by hyperforin and hyperoside on rat C6 glioblastoma cells measured by fluorescence correlation spectroscopy. Biochemistry. 2007 May 1;46(17):5106-13. Epub 2007 Apr 7. [PubMed
]
- Lucin KM, Sanders VM, Jones TB, Malarkey WB, Popovich PG: Impaired antibody synthesis after spinal cord injury is level dependent and is due to sympathetic nervous system dysregulation. Exp Neurol. 2007 Sep;207(1):75-84. Epub 2007 Jun 2. [PubMed
]
- Ozakca I, Arioglu E, Guner S, Altan VM, Ozcelikay AT: Role of Beta-3-Adrenoceptor in Catecholamine-Induced Relaxations in Gastric Fundus from Control and Diabetic Rats. Pharmacology. 2007 Jul 6;80(4):227-238. [PubMed
]
|
|
Drug Target 4
[top]
|
| Target 4 ID |
828 |
| Target 4 Name |
Phenylalanine-4-hydroxylase |
| Target 4 Synonyms |
- EC 1.14.16.1
- PAH
- Phe-4- monooxygenase
|
| Target 4 Gene Name |
PAH |
| Target 4 Protein Sequence |
>Phenylalanine-4-hydroxylase
MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDV
NLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPW
FPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYM
EEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGF
RLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFA
QFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSE
KPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQR
IEVLDNTQQLKILADSINSEIGILCSALQKIK
|
| Target 4 Number of Residues |
459 |
| Target 4 Molecular Weight |
51863 |
| Target 4 Theoretical pI |
6.57 |
| Target 4 GO Classification |
|
Function
|
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
phenylalanine 4-monooxygenase activity
amine binding
amino acid binding
binding
ion binding
cation binding
transition metal ion binding
iron ion binding
catalytic activity
oxidoreductase activity
monooxygenase activity |
|
Process
|
L-phenylalanine metabolism
L-phenylalanine catabolism
physiological process
metabolism
cellular metabolism
amino acid and derivative metabolism
amino acid metabolism
aromatic amino acid family metabolism |
|
Component
|
| Not Available |
|
| Target 4 General Function |
Amino acid transport and metabolism |
| Target 4 Specific Function |
Not Available |
| Target 4 Pathways |
| Name |
SMPDB Link |
KEGG Link |
| Phenylalanine, tyrosine and tryptophan biosynthesis |
|
map00400  |
|
| Target 4 Reactions |
- L-phenylalanine + tetrahydrobiopterin + O2 = L-tyrosine + 4a-hydroxytetrahydrobiopterin
|
| Target 4 Pfam Domain Function |
|
| Target 4 Signals |
|
| Target 4 Transmembrane Regions |
|
| Target 4 Essentiality |
Non-Essential |
| Target 4 GenBank ID Protein |
189937  |
| Target 4 UniProtKB/Swiss-Prot ID |
P00439  |
| Target 4 UniProtKB/Swiss-Prot Entry Name |
PH4H_HUMAN  |
| Target 4 PDB ID |
2PHM  |
| Target 4 PDB File |
Show |
| Target 4 3D Structure |
|
| Target 4 Cellular Location |
Not Available |
| Target 4 Gene Sequence |
>1359 bp
ATGTCCACTGCGGTCCTGGAAAACCCAGGCTTGGGCAGGAAACTCTCTGACTTTGGACAG
GAAACAAGCTATATTGAAGACAACTGCAATCAAAATGGTGCCATATCACTGATCTTCTCA
CTCAAAGAAGAAGTTGGTGCATTGGCCAAAGTATTGCGCTTATTTGAGGAGAATGATGTA
AACCTGACCCACATTGAATCTAGACCTTCTCGTTTAAAGAAAGATGAGTATGAATTTTTC
ACCCATTTGGATAAACGTAGCCTGCCTGCTCTGACAAACATCATCAAGATCTTGAGGCAT
GACATTGGTGCCACTGTCCATGAGCTTTCACGAGATAAGAAGAAAGACACAGTGCCCTGG
TTCCCAAGAACCATTCAAGAGCTGGACAGATTTGCCAATCAGATTCTCAGCTATGGAGCG
GAACTGGATGCTGACCACCCTGGTTTTAAAGATCCTGTGTACCGTGCAAGACGGAAGCAG
TTTGCTGACATTGCCTACAACTACCGCCATGGGCAGCCCATCCCTCGAGTGGAATACATG
GAGGAAGAAAAGAAAACATGGGGCACAGTGTTCAAGACTCTGAAGTCCTTGTATAAAACC
CATGCTTGCTATGAGTACAATCACATTTTTCCACTTCTTGAAAAGTACTGTGGCTTCCAT
GAAGATAACATTCCCCAGCTGGAAGACGTTTCTCAATTCCTGCAGACTTGCACTGGTTTC
CGCCTCCGACCTGTGGCTGGCCTGCTTTCCTCTCGGGATTTCTTGGGTGGCCTGGCCTTC
CGAGTCTTCCACTGCACACAGTACATCAGACATGGATCCAAGCCCATGTATACCCCCGAA
CCTGACATCTGCCATGAGCTGTTGGGACATGTGCCCTTGTTTTCAGATCGCAGCTTTGCC
CAGTTTTCCCAGGAAATTGGCCTTGCCTCTCTGGGTGCACCTGATGAATACATTGAAAAG
CTCGCCACAATTTACTGGTTTACTGTGGAGTTTGGGCTCTGCAAACAAGGAGACTCCATA
AAGGCATATGGTGCTGGGCTCCTGTCATCCTTTGGTGAATTACAGTACTGCTTATCAGAG
AAGCCAAAGCTTCTCCCCCTGGAGCTGGAGAAGACAGCCATCCAAAATTACACTGTCACG
GAGTTCCAGCCCCTGTATTACGTGGCAGAGAGTTTTAATGATGCCAAGGAGAAAGTAAGG
AACTTTGCTGCCACAATACCTCGGCCCTTCTCAGTTCGCTACGACCCATACACCCAAAGG
ATTGAGGTCTTGGACAATACCCAGCAGCTTAAGATTTTGGCTGATTCCATTAACAGTGAA
ATTGGAATCCTTTGCAGTGCCCTCCAGAAAATAAAGTAA
|
| Target 4 GenBank Gene ID |
|
| Target 4 GeneCard ID |
PAH  |
| Target 4 GenAtlas ID |
PAH  |
| Target 4 HGNC ID |
HGNC:8582  |
| Target 4 Chromosome Location |
12 |
| Target 4 Locus |
12q22-q24.2 |
| Target 4 SNPs |
SNPJam Report  |
| Target 4 General References |
- Hennermann JB, Vetter B, Wolf C, Windt E, Buhrdel P, Seidel J, Monch E, Kulozik AE: Phenylketonuria and hyperphenylalaninemia in eastern Germany: a characteristic molecular profile and 15 novel mutations. Hum Mutat. 2000;15(3):254-60. [PubMed
]
- Erlandsen H, Bjorgo E, Flatmark T, Stevens RC: Crystal structure and site-specific mutagenesis of pterin-bound human phenylalanine hydroxylase. Biochemistry. 2000 Mar 7;39(9):2208-17. [PubMed
]
- Acosta A, Silva W Jr, Carvalho T, Gomes M, Zago M: Mutations of the phenylalanine hydroxylase (PAH) gene in Brazilian patients with phenylketonuria. Hum Mutat. 2001 Feb;17(2):122-30. [PubMed
]
- Gjetting T, Petersen M, Guldberg P, Guttler F: Missense mutations in the N-terminal domain of human phenylalanine hydroxylase interfere with binding of regulatory phenylalanine. Am J Hum Genet. 2001 Jun;68(6):1353-60. Epub 2001 Apr 20. [PubMed
]
- Yang Y, Drummond-Borg M, Garcia-Heras J: Molecular analysis of phenylketonuria (PKU) in newborns from Texas. Hum Mutat. 2001 Jun;17(6):523. [PubMed
]
- Gjetting T, Romstad A, Haavik J, Knappskog PM, Acosta AX, Silva WA Jr, Zago MA, Guldberg P, Guttler F: A phenylalanine hydroxylase amino acid polymorphism with implications for molecular diagnostics. Mol Genet Metab. 2001 Jul;73(3):280-4. [PubMed
]
- Andersen OA, Flatmark T, Hough E: High resolution crystal structures of the catalytic domain of human phenylalanine hydroxylase in its catalytically active Fe(II) form and binary complex with tetrahydrobiopterin. J Mol Biol. 2001 Nov 23;314(2):279-91. [PubMed
]
- Eisensmith RC, Woo SL: Molecular basis of phenylketonuria and related hyperphenylalaninemias: mutations and polymorphisms in the human phenylalanine hydroxylase gene. Hum Mutat. 1992;1(1):13-23. [PubMed
]
- Lin CH, Hsiao KJ, Tsai TF, Chao HK, Su TS: Identification of a missense phenylketonuria mutation at codon 408 in Chinese. Hum Genet. 1992 Aug;89(6):593-6. [PubMed
]
- Economou-Petersen E, Henriksen KF, Guldberg P, Guttler F: Molecular basis for nonphenylketonuria hyperphenylalaninemia. Genomics. 1992 Sep;14(1):1-5. [PubMed
]
- 1363837 Jaruzelska J, Melle D, Matuszak R, Borski K, Munnich A: A new 15 bp deletion in exon 11 of the phenylalanine hydroxylase gene in phenylketonuria. Hum Mol Genet. 1992 Dec;1(9):763-4.
- 1363838 Desviat LR, Perez B, Ugarte M: A new PKU mutation associated with haplotype 12. Hum Mol Genet. 1992 Dec;1(9):765-6.
- 1671810 Dianzani I, Forrest SM, Camaschella C, Saglio G, Ponzone A, Cotton RG: Screening for mutations in the phenylalanine hydroxylase gene from Italian patients with phenylketonuria by using the chemical cleavage method: a new splice mutation. Am J Hum Genet. 1991 Mar;48(3):631-5.
- 1672290 Dworniczak B, Grudda K, Stumper J, Bartholome K, Aulehla-Scholz C, Horst J: Phenylalanine hydroxylase gene: novel missense mutation in exon 7 causing severe phenylketonuria. Genomics. 1991 Jan;9(1):193-9.
- 1672294 Okano Y, Wang T, Eisensmith RC, Longhi R, Riva E, Giovannini M, Cerone R, Romano C, Woo SL: Phenylketonuria missense mutations in the Mediterranean. Genomics. 1991 Jan;9(1):96-103.
- 1679029 Konecki DS, Lichter-Konecki U: The phenylketonuria locus: current knowledge about alleles and mutations of the phenylalanine hydroxylase gene in various populations. Hum Genet. 1991 Aug;87(4):377-88.
- 1679030 Konecki DS, Schlotter M, Trefz FK, Lichter-Konecki U: The identification of two mis-sense mutations at the PAH gene locus in a Turkish patient with phenylketonuria. Hum Genet. 1991 Aug;87(4):389-93.
- 1709636 Caillaud C, Lyonnet S, Rey F, Melle D, Frebourg T, Berthelon M, Vilarinho L, Vaz Osorio R, Rey J, Munnich A: A 3-base pair in-frame deletion of the phenylalanine hydroxylase gene results in a kinetic variant of phenylketonuria. J Biol Chem. 1991 May 25;266(15):9351-4.
- 1975559 Svensson E, Andersson B, Hagenfeldt L: Two mutations within the coding sequence of the phenylalanine hydroxylase gene. Hum Genet. 1990 Aug;85(3):300-4.
- 2014802 Hofman KJ, Steel G, Kazazian HH, Valle D: Phenylketonuria in U.S. blacks: molecular analysis of the phenylalanine hydroxylase gene. Am J Hum Genet. 1991 Apr;48(4):791-8.
- 2246858 Cotton RG: Heterogeneity of phenylketonuria at the clinical, protein and DNA levels. J Inherit Metab Dis. 1990;13(5):739-50.
- 2461704 Cotton RG, McAdam W, Jennings I, Morgan FJ: A monoclonal antibody to aromatic amino acid hydroxylases. Identification of the epitope. Biochem J. 1988 Oct 1;255(1):193-6.
- 2564729 Lyonnet S, Caillaud C, Rey F, Berthelon M, Frezal J, Rey J, Munnich A: Molecular genetics of phenylketonuria in Mediterranean countries: a mutation associated with partial phenylalanine hydroxylase deficiency. Am J Hum Genet. 1989 Apr;44(4):511-7.
- 2615649 Hofman KJ, Antonarakis SE, Missiou-Tsangaraki S, Boehm CD, Valle D: Phenylketonuria in the Greek population. Haplotype analysis of the phenylalanine hydroxylase gene and identification of a PKU mutation. Mol Biol Med. 1989 Jun;6(3):245-50.
- 2840952 Lichter-Konecki U, Konecki DS, DiLella AG, Brayton K, Marvit J, Hahn TM, Trefz FK, Woo SL: Phenylalanine hydroxylase deficiency caused by a single base substitution in an exon of the human phenylalanine hydroxylase gene. Biochemistry. 1988 Apr 19;27(8):2881-5.
- 2986678 Kwok SC, Ledley FD, DiLella AG, Robson KJ, Woo SL: Nucleotide sequence of a full-length complementary DNA clone and amino acid sequence of human phenylalanine hydroxylase. Biochemistry. 1985 Jan 29;24(3):556-61.
- 7833954 Benit P, Rey F, Melle D, Munnich A, Rey J: Five novel missense mutations of the phenylalanine hydroxylase gene in phenylketonuria. Hum Mutat. 1994;4(3):229-31.
- 8068076 Goebel-Schreiner B, Schreiner R: Identification of a new missense mutation in Japanese phenylketonuric patients. J Inherit Metab Dis. 1993;16(6):950-6.
- 8088845 Guldberg P, Henriksen KF, Thony B, Blau N, Guttler F: Molecular heterogeneity of nonphenylketonuria hyperphenylalaninemia in 25 Danish patients. Genomics. 1994 May 15;21(2):453-5.
- 8098245 Abadie V, Jaruzelska J, Lyonnet S, Millasseau P, Berthelon M, Rey F, Munnich A, Rey J: Illegitimate transcription of the phenylalanine hydroxylase gene in lymphocytes for identification of mutations in phenylketonuria. Hum Mol Genet. 1993 Jan;2(1):31-4.
- 8406445 Guldberg P, Henriksen KF, Guttler F: Molecular analysis of phenylketonuria in Denmark: 99% of the mutations detected by denaturing gradient gel electrophoresis. Genomics. 1993 Jul;17(1):141-6.
- 8594560 Hoang L, Byck S, Prevost L, Scriver CR: PAH Mutation Analysis Consortium Database: a database for disease-producing and other allelic variation at the human PAH locus. Nucleic Acids Res. 1996 Jan 1;24(1):127-31.
- 8889583 Knappskog PM, Eiken HG, Martinez A, Bruland O, Apold J, Flatmark T: PKU mutation (D143G) associated with an apparent high residual enzyme activity: expression of a kinetic variant form of phenylalanine hydroxylase in three different systems. Hum Mutat. 1996;8(3):236-46.
- 8889590 Guldberg P, Mallmann R, Henriksen KF, Guttler F: Phenylalanine hydroxylase deficiency in a population in Germany: mutational profile and nine novel mutations. Hum Mutat. 1996;8(3):276-9.
- 9048935 Argiolas A, Bosco P, Cali F, Ceratto N, Anello G, Riva E, Biasucci G, Carducci C, Romano V: Two novel PAH gene mutations detected in Italian phenylketonuric patients. Hum Genet. 1997 Feb;99(2):275-8.
- 9101291 Byck S, Tyfield L, Carter K, Scriver CR: Prediction of multiple hypermutable codons in the human PAH gene: codon 280 contains recurrent mutations in Quebec and other populations. Hum Mutat. 1997;9(4):316-21.
- 9406548 Erlandsen H, Fusetti F, Martinez A, Hough E, Flatmark T, Stevens RC: Crystal structure of the catalytic domain of human phenylalanine hydroxylase reveals the structural basis for phenylketonuria. Nat Struct Biol. 1997 Dec;4(12):995-1000.
- 9450897 Waters PJ, Parniak MA, Nowacki P, Scriver CR: In vitro expression analysis of mutations in phenylalanine hydroxylase: linking genotype to phenotype and structure to function. Hum Mutat. 1998;11(1):4-17.
- 9452061 Park YS, Seoung CS, Lee SW, Oh KH, Lee DH, Yim J: Identification of three novel mutations in Korean phenylketonuria patients: R53H, N207D, and Y325X. Hum Mutat. 1998;Suppl 1:S121-2.
- 9452062 Michiels L, Francois B, Raus J, Vandevyver C: Identification of seven new mutations in the phenylalanine hydroxylase gene, associated with hyperphenylalaninemia in the Belgian population. Hum Mutat. 1998;Suppl 1:S123-4.
- 9521426 Bosco P, Cali F, Meli C, Mollica F, Zammarchi E, Cerone R, Vanni C, Palillo L, Greco D, Romano V: Eight new mutations of the phenylalanine hydroxylase gene in Italian patients with hyperphenylalaninemia. Hum Mutat. 1998;11(3):240-3.
- 9600453 De Lucca M, Perez B, Desviat LR, Ugarte M: Molecular basis of phenylketonuria in Venezuela: presence of two novel null mutations. Hum Mutat. 1998;11(5):354-9.
- 9642259 Fusetti F, Erlandsen H, Flatmark T, Stevens RC: Structure of tetrameric human phenylalanine hydroxylase and its implications for phenylketonuria. J Biol Chem. 1998 Jul 3;273(27):16962-7.
- 9792407 Popescu T, Blazkova M, Kozak L, Jebeleanu G, Popescu A: Mutation spectrum and phenylalanine hydroxylase RFLP/VNTR background in 44 Romanian phenylketonuric alleles. Hum Mutat. 1998;12(5):314-9.
- 9792411 Waters PJ, Parniak MA, Hewson AS, Scriver CR: Alterations in protein aggregation and degradation due to mild and severe missense mutations (A104D, R157N) in the human phenylalanine hydroxylase gene (PAH). Hum Mutat. 1998;12(5):344-54.
- 9843368 Erlandsen H, Flatmark T, Stevens RC, Hough E: Crystallographic analysis of the human phenylalanine hydroxylase catalytic domain with bound catechol inhibitors at 2.0 A resolution. Biochemistry. 1998 Nov 10;37(45):15638-46.
- 9852673 Kibayashi M, Nagao M, Chiba S: Mutation analysis of the phenylalanine hydroxylase gene and its clinical implications in two Japanese patients with non-phenylketonuria hyperphenylalaninemia. J Hum Genet. 1998;43(4):231-6.
|
| Target 4 Drug References |
- Erlandsen H, Flatmark T, Stevens RC, Hough E: Crystallographic analysis of the human phenylalanine hydroxylase catalytic domain with bound catechol inhibitors at 2.0 A resolution. Biochemistry. 1998 Nov 10;37(45):15638-46. [PubMed
]
|