You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameLepirudin
Accession NumberDB00001  (BTD00024, BIOD00024)
TypeBiotech
GroupsApproved
DescriptionLepirudin is identical to natural hirudin except for substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. It is produced via yeast cells. Bayer ceased the production of lepirudin (Refludan) effective May 31, 2012.
Protein structureDb00001
Related Articles
Protein chemical formulaC287H440N80O110S6
Protein average weight6963.425 Da
Sequences
>DB00001 sequence
LVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIP
EEYLQ
Download FASTA Format
Synonyms
Hirudin variant-1
Lepirudin recombinant
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Refludanpowder for solution50 mgintravenousBayer Inc2000-01-312013-07-26Canada
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
RefludanConcentrate for solution for injection50 mgIntravenous useCelgene Europe Ltd.1997-03-13Not applicableEu
RefludanConcentrate for solution for injection50 mgIntravenous useCelgene Europe Ltd.1997-03-13Not applicableEu
RefludanConcentrate for solution for injection20 mgIntravenous useCelgene Europe Ltd.1997-03-13Not applicableEu
RefludanConcentrate for solution for injection20 mgIntravenous useCelgene Europe Ltd.1997-03-13Not applicableEu
International BrandsNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNIIY43GF64R34
CAS number138068-37-8
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationFor the treatment of heparin-induced thrombocytopenia
PharmacodynamicsLepirudin is used to break up clots and to reduce thrombocytopenia. It binds to thrombin and prevents thrombus or clot formation. It is a highly potent, selective, and essentially irreversible inhibitor of thrombin and clot-bond thrombin. Lepirudin requires no cofactor for its anticoagulant action. Lepirudin is a recombinant form of hirudin, an endogenous anticoagulant found in medicinal leeches.
Mechanism of actionLepirudin forms a stable non-covalent complex with alpha-thrombin, thereby abolishing its ability to cleave fibrinogen and initiate the clotting cascade. The inhibition of thrombin prevents the blood clotting cascade.
Related Articles
AbsorptionBioavailability is 100% following injection.
Volume of distribution
  • 12.2 L [Healthy young subjects (n = 18, age 18-60 years)]
  • 18.7 L [Healthy elderly subjects (n = 10, age 65-80 years)]
  • 18 L [Renally impaired patients (n = 16, creatinine clearance below 80 mL/min)]
  • 32.1 L [HIT patients (n = 73)]
Protein bindingNot Available
Metabolism

Lepirudin is thought to be metabolized by release of amino acids via catabolic hydrolysis of the parent drug. However, con-clusive data are not available. About 48% of the administration dose is excreted in the urine which consists of unchanged drug (35%) and other fragments of the parent drug.

Route of eliminationLepirudin is thought to be metabolized by release of amino acids via catabolic hydrolysis of the parent drug. About 48% of the administration dose is excreted in the urine which consists of unchanged drug (35%) and other fragments of the parent drug.
Half lifeApproximately 1.3 hours
Clearance
  • 164 ml/min [Healthy 18-60 yrs]
  • 139 ml/min [Healthy 65-80 yrs]
  • 61 ml/min [renal impaired]
  • 114 ml/min [HIT (Heparin-induced thrombocytopenia)]
ToxicityIn case of overdose (eg, suggested by excessively high aPTT values) the risk of bleeding is increased.
Affected organisms
  • Humans and other mammals
Pathways
PathwayCategorySMPDB ID
Lepirudin Action PathwayDrug actionSMP00278
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
Manufacturers
  • Bayer healthcare pharmaceuticals inc
Packagers
Dosage forms
FormRouteStrength
Concentrate for solution for injectionIntravenous use20 mg
Concentrate for solution for injectionIntravenous use50 mg
Powder for solutionintravenous50 mg
Prices
Unit descriptionCostUnit
Refludan 50 mg vial273.19USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1339104 No1997-07-292014-07-29Canada
US5180668 No1993-01-192010-01-19Us
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point65 °COtto, A. & Seckler, R. Eur. J. Biochem. 202:67-73 (1991)
hydrophobicity-0.777Not Available
isoelectric point4.04Not Available
References
Synthesis ReferenceNot Available
General References
  1. Smythe MA, Stephens JL, Koerber JM, Mattson JC: A comparison of lepirudin and argatroban outcomes. Clin Appl Thromb Hemost. 2005 Oct;11(4):371-4. [PubMed:16244762 ]
  2. Tardy B, Lecompte T, Boelhen F, Tardy-Poncet B, Elalamy I, Morange P, Gruel Y, Wolf M, Francois D, Racadot E, Camarasa P, Blouch MT, Nguyen F, Doubine S, Dutrillaux F, Alhenc-Gelas M, Martin-Toutain I, Bauters A, Ffrench P, de Maistre E, Grunebaum L, Mouton C, Huisse MG, Gouault-Heilmann M, Lucke V: Predictive factors for thrombosis and major bleeding in an observational study in 181 patients with heparin-induced thrombocytopenia treated with lepirudin. Blood. 2006 Sep 1;108(5):1492-6. Epub 2006 May 11. [PubMed:16690967 ]
  3. Lubenow N, Eichler P, Lietz T, Greinacher A: Lepirudin in patients with heparin-induced thrombocytopenia - results of the third prospective study (HAT-3) and a combined analysis of HAT-1, HAT-2, and HAT-3. J Thromb Haemost. 2005 Nov;3(11):2428-36. [PubMed:16241940 ]
  4. Google books [Link]
External Links
ATC CodesB01AE02
AHFS Codes
  • 20:12.04.12
PDB Entries
FDA labelDownload (128 KB)
MSDSDownload (567 KB)
Interactions
Drug Interactions
Drug
AbacavirThe serum concentration of Abacavir can be decreased when it is combined with Lepirudin.
AbciximabLepirudin may increase the anticoagulant activities of Abciximab.
AceclofenacAceclofenac may increase the anticoagulant activities of Lepirudin.
AcenocoumarolLepirudin may increase the anticoagulant activities of Acenocoumarol.
Acetylsalicylic acidAcetylsalicylic acid may increase the anticoagulant activities of Lepirudin.
AdapaleneAdapalene may increase the anticoagulant activities of Lepirudin.
AlfuzosinThe serum concentration of Alfuzosin can be increased when it is combined with Lepirudin.
AllylestrenolThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Allylestrenol.
AlprazolamThe serum concentration of Alprazolam can be increased when it is combined with Lepirudin.
AlprostadilAlprostadil may increase the anticoagulant activities of Lepirudin.
AlteplaseAlteplase may increase the anticoagulant activities of Lepirudin.
AltrenogestThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Altrenogest.
ALX-0081ALX-0081 may increase the anticoagulant activities of Lepirudin.
AmineptineThe serum concentration of Amineptine can be increased when it is combined with Lepirudin.
AminophyllineThe serum concentration of Aminophylline can be decreased when it is combined with Lepirudin.
Aminosalicylic AcidAminosalicylic Acid may increase the anticoagulant activities of Lepirudin.
AmitriptylineThe serum concentration of Amitriptyline can be increased when it is combined with Lepirudin.
AnagrelideAnagrelide may increase the anticoagulant activities of Lepirudin.
AncrodLepirudin may increase the anticoagulant activities of Ancrod.
AnistreplaseAnistreplase may increase the anticoagulant activities of Lepirudin.
AntipyrineAntipyrine may increase the anticoagulant activities of Lepirudin.
Antithrombin III humanLepirudin may increase the anticoagulant activities of Antithrombin III human.
ApixabanApixaban may increase the anticoagulant activities of Lepirudin.
ApremilastApremilast may increase the anticoagulant activities of Lepirudin.
AprotininThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Aprotinin.
ArdeparinLepirudin may increase the anticoagulant activities of Ardeparin.
ArgatrobanLepirudin may increase the anticoagulant activities of Argatroban.
AstaxanthinAstaxanthin may increase the anticoagulant activities of Lepirudin.
AtorvastatinThe serum concentration of Atorvastatin can be increased when it is combined with Lepirudin.
AzapropazoneAzapropazone may increase the anticoagulant activities of Lepirudin.
AzelastineAzelastine may increase the anticoagulant activities of Lepirudin.
BalsalazideBalsalazide may increase the anticoagulant activities of Lepirudin.
BatroxobinBatroxobin may increase the anticoagulant activities of Lepirudin.
BazedoxifeneBazedoxifene may decrease the anticoagulant activities of Lepirudin.
BecaplerminLepirudin may increase the anticoagulant activities of Becaplermin.
BemiparinBemiparin may increase the anticoagulant activities of Lepirudin.
BenoxaprofenBenoxaprofen may increase the anticoagulant activities of Lepirudin.
BeraprostBeraprost may increase the anticoagulant activities of Lepirudin.
BivalirudinLepirudin may increase the anticoagulant activities of Bivalirudin.
BoceprevirThe serum concentration of Lepirudin can be decreased when it is combined with Boceprevir.
BromfenacBromfenac may increase the anticoagulant activities of Lepirudin.
BromocriptineThe serum concentration of Bromocriptine can be increased when it is combined with Lepirudin.
CabergolineThe serum concentration of Cabergoline can be increased when it is combined with Lepirudin.
CangrelorCangrelor may increase the anticoagulant activities of Lepirudin.
CarbamazepineThe metabolism of Lepirudin can be increased when combined with Carbamazepine.
CarprofenCarprofen may increase the anticoagulant activities of Lepirudin.
CastanospermineCastanospermine may increase the anticoagulant activities of Lepirudin.
CelecoxibCelecoxib may increase the anticoagulant activities of Lepirudin.
CertoparinLepirudin may increase the anticoagulant activities of Certoparin.
ChloroquineChloroquine may increase the anticoagulant activities of Lepirudin.
ChlorotrianiseneChlorotrianisene may decrease the anticoagulant activities of Lepirudin.
CilostazolCilostazol may increase the anticoagulant activities of Lepirudin.
CisaprideThe serum concentration of Cisapride can be increased when it is combined with Lepirudin.
Citric AcidLepirudin may increase the anticoagulant activities of Citric Acid.
ClarithromycinThe therapeutic efficacy of Clarithromycin can be decreased when used in combination with Lepirudin.
ClomipramineThe serum concentration of Clomipramine can be increased when it is combined with Lepirudin.
ClonixinClonixin may increase the anticoagulant activities of Lepirudin.
ClopidogrelClopidogrel may increase the anticoagulant activities of Lepirudin.
CollagenaseThe risk or severity of adverse effects can be increased when Lepirudin is combined with Collagenase.
Conjugated Equine EstrogensConjugated Equine Estrogens may decrease the anticoagulant activities of Lepirudin.
CyclobenzaprineThe serum concentration of Cyclobenzaprine can be increased when it is combined with Lepirudin.
CyclophosphamideThe risk or severity of adverse effects can be increased when Lepirudin is combined with Cyclophosphamide.
CyclosporineThe serum concentration of Cyclosporine can be increased when it is combined with Lepirudin.
D-LimoneneD-Limonene may increase the anticoagulant activities of Lepirudin.
Dabigatran etexilateDabigatran etexilate may increase the anticoagulant activities of Lepirudin.
DalteparinLepirudin may increase the anticoagulant activities of Dalteparin.
DanaparoidLepirudin may increase the anticoagulant activities of Danaparoid.
DasatinibDasatinib may increase the anticoagulant activities of Lepirudin.
DeferasiroxThe risk or severity of adverse effects can be increased when Lepirudin is combined with Deferasirox.
DefibrotideDefibrotide may increase the anticoagulant activities of Lepirudin.
DelavirdineThe serum concentration of Delavirdine can be decreased when it is combined with Lepirudin.
Deoxycholic AcidThe risk or severity of adverse effects can be increased when Lepirudin is combined with Deoxycholic Acid.
DesipramineThe serum concentration of Desipramine can be increased when it is combined with Lepirudin.
DesirudinLepirudin may increase the anticoagulant activities of Desirudin.
DesmoteplaseDesmoteplase may increase the anticoagulant activities of Lepirudin.
DesogestrelThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Desogestrel.
DextranLepirudin may increase the anticoagulant activities of Dextran.
Dextran 40Lepirudin may increase the anticoagulant activities of Dextran 40.
Dextran 70Lepirudin may increase the anticoagulant activities of Dextran 70.
Dextran 75Lepirudin may increase the anticoagulant activities of Dextran 75.
DiclofenacDiclofenac may increase the anticoagulant activities of Lepirudin.
DicoumarolLepirudin may increase the anticoagulant activities of Dicoumarol.
DienestrolDienestrol may decrease the anticoagulant activities of Lepirudin.
DienogestThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Dienogest.
DiethylstilbestrolDiethylstilbestrol may decrease the anticoagulant activities of Lepirudin.
DiflunisalDiflunisal may increase the anticoagulant activities of Lepirudin.
DigoxinThe serum concentration of Digoxin can be increased when it is combined with Lepirudin.
DihydroergotamineThe serum concentration of Dihydroergotamine can be increased when it is combined with Lepirudin.
DipyridamoleDipyridamole may increase the anticoagulant activities of Lepirudin.
DitazoleDitazole may increase the anticoagulant activities of Lepirudin.
DosulepinThe serum concentration of Dosulepin can be increased when it is combined with Lepirudin.
DoxepinThe serum concentration of Doxepin can be increased when it is combined with Lepirudin.
DrospirenoneThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Drospirenone.
Drotrecogin alfaDrotrecogin alfa may increase the anticoagulant activities of Lepirudin.
DroxicamDroxicam may increase the anticoagulant activities of Lepirudin.
DydrogesteroneThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Dydrogesterone.
DyphyllineThe serum concentration of Dyphylline can be decreased when it is combined with Lepirudin.
Edetic AcidLepirudin may increase the anticoagulant activities of Edetic Acid.
EdoxabanEdoxaban may increase the anticoagulant activities of Lepirudin.
EnfuvirtideThe serum concentration of Enfuvirtide can be increased when it is combined with Lepirudin.
EnoxaparinLepirudin may increase the anticoagulant activities of Enoxaparin.
EpinastineEpinastine may increase the anticoagulant activities of Lepirudin.
EpirizoleEpirizole may increase the anticoagulant activities of Lepirudin.
EpoprostenolEpoprostenol may increase the anticoagulant activities of Lepirudin.
EpoprostenolThe risk or severity of adverse effects can be increased when Lepirudin is combined with Epoprostenol.
EptifibatideEptifibatide may increase the anticoagulant activities of Lepirudin.
Ergoloid mesylateThe serum concentration of Ergoloid mesylate can be increased when it is combined with Lepirudin.
ErgonovineThe serum concentration of Ergonovine can be increased when it is combined with Lepirudin.
ErgotamineThe serum concentration of Ergotamine can be increased when it is combined with Lepirudin.
EsmirtazapineThe serum concentration of Esmirtazapine can be increased when it is combined with Lepirudin.
EstradiolEstradiol may decrease the anticoagulant activities of Lepirudin.
EstriolEstriol may decrease the anticoagulant activities of Lepirudin.
EstroneEstrone may decrease the anticoagulant activities of Lepirudin.
EtanerceptEtanercept may increase the anticoagulant activities of Lepirudin.
Ethinyl EstradiolEthinyl Estradiol may decrease the anticoagulant activities of Lepirudin.
Ethyl biscoumacetateLepirudin may increase the anticoagulant activities of Ethyl biscoumacetate.
EtodolacEtodolac may increase the anticoagulant activities of Lepirudin.
EtofenamateEtofenamate may increase the anticoagulant activities of Lepirudin.
EtonogestrelThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Etonogestrel.
EtoricoxibEtoricoxib may increase the anticoagulant activities of Lepirudin.
EtravirineThe serum concentration of Etravirine can be decreased when it is combined with Lepirudin.
Evening primrose oilEvening primrose oil may increase the anticoagulant activities of Lepirudin.
exisulindexisulind may increase the anticoagulant activities of Lepirudin.
FenbufenFenbufen may increase the anticoagulant activities of Lepirudin.
FenoprofenFenoprofen may increase the anticoagulant activities of Lepirudin.
FibrinolysinFibrinolysin may increase the anticoagulant activities of Lepirudin.
FloctafenineFloctafenine may increase the anticoagulant activities of Lepirudin.
FlunixinFlunixin may increase the anticoagulant activities of Lepirudin.
FlurbiprofenFlurbiprofen may increase the anticoagulant activities of Lepirudin.
Fondaparinux sodiumLepirudin may increase the anticoagulant activities of Fondaparinux sodium.
GarlicThe serum concentration of Lepirudin can be decreased when it is combined with Garlic.
GenisteinGenistein may decrease the anticoagulant activities of Lepirudin.
GestodeneThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Gestodene.
HeminHemin may increase the anticoagulant activities of Lepirudin.
HeparinLepirudin may increase the anticoagulant activities of Heparin.
HexestrolHexestrol may decrease the anticoagulant activities of Lepirudin.
HirulogLepirudin may increase the anticoagulant activities of Hirulog.
HMPL-004HMPL-004 may increase the anticoagulant activities of Lepirudin.
Hydroxyprogesterone caproateThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Hydroxyprogesterone caproate.
Ibritumomab tiuxetanThe risk or severity of adverse effects can be increased when Lepirudin is combined with Ibritumomab tiuxetan.
IbrutinibThe risk or severity of adverse effects can be increased when Ibrutinib is combined with Lepirudin.
IbudilastIbudilast may increase the anticoagulant activities of Lepirudin.
IbuprofenIbuprofen may increase the anticoagulant activities of Lepirudin.
IbuproxamIbuproxam may increase the anticoagulant activities of Lepirudin.
IcatibantIcatibant may increase the anticoagulant activities of Lepirudin.
Icosapent ethylIcosapent ethyl may increase the anticoagulant activities of Lepirudin.
IfenprodilIfenprodil may increase the anticoagulant activities of Lepirudin.
IloprostIloprost may increase the anticoagulant activities of Lepirudin.
IloprostThe risk or severity of adverse effects can be increased when Lepirudin is combined with Iloprost.
ImipramineThe serum concentration of Imipramine can be increased when it is combined with Lepirudin.
IndomethacinIndomethacin may increase the anticoagulant activities of Lepirudin.
IndoprofenIndoprofen may increase the anticoagulant activities of Lepirudin.
IsoxicamIsoxicam may increase the anticoagulant activities of Lepirudin.
KebuzoneKebuzone may increase the anticoagulant activities of Lepirudin.
KetoprofenKetoprofen may increase the anticoagulant activities of Lepirudin.
KetorolacKetorolac may increase the anticoagulant activities of Lepirudin.
LeflunomideLeflunomide may increase the anticoagulant activities of Lepirudin.
LevonorgestrelThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Levonorgestrel.
LimaprostThe risk or severity of adverse effects can be increased when Limaprost is combined with Lepirudin.
LornoxicamLornoxicam may increase the anticoagulant activities of Lepirudin.
LovastatinThe serum concentration of Lovastatin can be increased when it is combined with Lepirudin.
LoxoprofenLoxoprofen may increase the anticoagulant activities of Lepirudin.
LumiracoxibLumiracoxib may increase the anticoagulant activities of Lepirudin.
Magnesium salicylateMagnesium salicylate may increase the anticoagulant activities of Lepirudin.
MasoprocolMasoprocol may increase the anticoagulant activities of Lepirudin.
Meclofenamic acidMeclofenamic acid may increase the anticoagulant activities of Lepirudin.
MedrogestoneThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Medrogestone.
Medroxyprogesterone acetateThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Medroxyprogesterone acetate.
Mefenamic acidMefenamic acid may increase the anticoagulant activities of Lepirudin.
Megestrol acetateThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Megestrol acetate.
MeloxicamMeloxicam may increase the anticoagulant activities of Lepirudin.
MesalazineMesalazine may increase the anticoagulant activities of Lepirudin.
MestranolMestranol may decrease the anticoagulant activities of Lepirudin.
MetamizoleMetamizole may increase the anticoagulant activities of Lepirudin.
MidazolamThe serum concentration of Midazolam can be increased when it is combined with Lepirudin.
MilrinoneMilrinone may increase the anticoagulant activities of Lepirudin.
MirtazapineThe serum concentration of Mirtazapine can be increased when it is combined with Lepirudin.
Mycophenolate mofetilMycophenolate mofetil may increase the anticoagulant activities of Lepirudin.
Mycophenolic acidMycophenolic acid may increase the anticoagulant activities of Lepirudin.
NabumetoneNabumetone may increase the anticoagulant activities of Lepirudin.
NadroparinLepirudin may increase the anticoagulant activities of Nadroparin.
NaftifineNaftifine may increase the anticoagulant activities of Lepirudin.
NaproxenNaproxen may increase the anticoagulant activities of Lepirudin.
NCX 4016NCX 4016 may increase the anticoagulant activities of Lepirudin.
NefazodoneThe serum concentration of Nefazodone can be increased when it is combined with Lepirudin.
NepafenacNepafenac may increase the anticoagulant activities of Lepirudin.
Niflumic AcidNiflumic Acid may increase the anticoagulant activities of Lepirudin.
NimesulideNimesulide may increase the anticoagulant activities of Lepirudin.
NintedanibThe risk or severity of adverse effects can be increased when Lepirudin is combined with Nintedanib.
NorethisteroneThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Norethisterone.
NortriptylineThe serum concentration of Nortriptyline can be increased when it is combined with Lepirudin.
ObinutuzumabThe risk or severity of adverse effects can be increased when Lepirudin is combined with Obinutuzumab.
OlopatadineOlopatadine may increase the anticoagulant activities of Lepirudin.
OlsalazineOlsalazine may increase the anticoagulant activities of Lepirudin.
Omacetaxine mepesuccinateThe risk or severity of adverse effects can be increased when Lepirudin is combined with Omacetaxine mepesuccinate.
Omega-3 fatty acidsOmega-3 fatty acids may increase the anticoagulant activities of Lepirudin.
OrgoteinOrgotein may increase the anticoagulant activities of Lepirudin.
OtamixabanLepirudin may increase the anticoagulant activities of Otamixaban.
OxaprozinOxaprozin may increase the anticoagulant activities of Lepirudin.
OxyphenbutazoneOxyphenbutazone may increase the anticoagulant activities of Lepirudin.
ParecoxibParecoxib may increase the anticoagulant activities of Lepirudin.
ParnaparinParnaparin may increase the anticoagulant activities of Lepirudin.
Pentosan PolysulfatePentosan Polysulfate may increase the anticoagulant activities of Lepirudin.
PentoxifyllinePentoxifylline may increase the anticoagulant activities of Lepirudin.
PethidineThe risk or severity of adverse effects can be increased when Lepirudin is combined with Pethidine.
PhenindioneLepirudin may increase the anticoagulant activities of Phenindione.
PhenprocoumonLepirudin may increase the anticoagulant activities of Phenprocoumon.
PhenylbutazonePhenylbutazone may increase the anticoagulant activities of Lepirudin.
PimecrolimusPimecrolimus may increase the anticoagulant activities of Lepirudin.
PimozideThe serum concentration of Pimozide can be increased when it is combined with Lepirudin.
PirfenidonePirfenidone may increase the anticoagulant activities of Lepirudin.
PiroxicamPiroxicam may increase the anticoagulant activities of Lepirudin.
PlasminPlasmin may increase the anticoagulant activities of Lepirudin.
Polyestradiol phosphatePolyestradiol phosphate may decrease the anticoagulant activities of Lepirudin.
PrasugrelPrasugrel may increase the anticoagulant activities of Lepirudin.
ProgesteroneThe therapeutic efficacy of Lepirudin can be decreased when used in combination with Progesterone.
PropacetamolPropacetamol may increase the anticoagulant activities of Lepirudin.
Protein CLepirudin may increase the anticoagulant activities of Protein C.
ProtocatechualdehydeLepirudin may increase the anticoagulant activities of Protocatechualdehyde.
ProtriptylineThe serum concentration of Protriptyline can be increased when it is combined with Lepirudin.
PTC299PTC299 may increase the anticoagulant activities of Lepirudin.
QuinestrolQuinestrol may decrease the anticoagulant activities of Lepirudin.
ResveratrolResveratrol may increase the anticoagulant activities of Lepirudin.
ReteplaseReteplase may increase the anticoagulant activities of Lepirudin.
ReviparinLepirudin may increase the anticoagulant activities of Reviparin.
RidogrelRidogrel may increase the anticoagulant activities of Lepirudin.
RiociguatThe serum concentration of Riociguat can be increased when it is combined with Lepirudin.
RivaroxabanLepirudin may increase the anticoagulant activities of Rivaroxaban.
RofecoxibRofecoxib may increase the anticoagulant activities of Lepirudin.
RosiglitazoneRosiglitazone may increase the anticoagulant activities of Lepirudin.
RosuvastatinThe serum concentration of Rosuvastatin can be increased when it is combined with Lepirudin.
SalicylamideSalicylamide may increase the anticoagulant activities of Lepirudin.
Salicylic acidSalicylic acid may increase the anticoagulant activities of Lepirudin.
SalsalateSalsalate may increase the anticoagulant activities of Lepirudin.
SCH-530348SCH-530348 may increase the anticoagulant activities of Lepirudin.
SelexipagSelexipag may increase the anticoagulant activities of Lepirudin.
SeratrodastSeratrodast may increase the anticoagulant activities of Lepirudin.
SevofluraneSevoflurane may increase the anticoagulant activities of Lepirudin.
SildenafilThe serum concentration of Sildenafil can be increased when it is combined with Lepirudin.
SimeprevirThe serum concentration of Simeprevir can be increased when it is combined with Lepirudin.
SimvastatinThe serum concentration of Simvastatin can be increased when it is combined with Lepirudin.
SRT501SRT501 may increase the anticoagulant activities of Lepirudin.
St. John's WortThe metabolism of Lepirudin can be increased when combined with St. John's Wort.
StreptokinaseStreptokinase may increase the anticoagulant activities of Lepirudin.
SugammadexSugammadex may increase the anticoagulant activities of Lepirudin.
SulfasalazineSulfasalazine may increase the anticoagulant activities of Lepirudin.
SulindacSulindac may increase the anticoagulant activities of Lepirudin.
SulodexideLepirudin may increase the anticoagulant activities of Sulodexide.
SuprofenSuprofen may increase the anticoagulant activities of Lepirudin.
Synthetic Conjugated Estrogens, ASynthetic Conjugated Estrogens, A may decrease the anticoagulant activities of Lepirudin.
Synthetic Conjugated Estrogens, BSynthetic Conjugated Estrogens, B may decrease the anticoagulant activities of Lepirudin.
TacrolimusThe metabolism of Tacrolimus can be decreased when combined with Lepirudin.
TemsirolimusThe risk or severity of adverse effects can be increased when Lepirudin is combined with Temsirolimus.
TenecteplaseTenecteplase may increase the anticoagulant activities of Lepirudin.
TenoxicamTenoxicam may increase the anticoagulant activities of Lepirudin.
TepoxalinTepoxalin may increase the anticoagulant activities of Lepirudin.
TeriflunomideTeriflunomide may increase the anticoagulant activities of Lepirudin.
TesmilifeneTesmilifene may increase the anticoagulant activities of Lepirudin.
TheophyllineThe serum concentration of Theophylline can be decreased when it is combined with Lepirudin.
TianeptineThe serum concentration of Tianeptine can be increased when it is combined with Lepirudin.
Tiaprofenic acidTiaprofenic acid may increase the anticoagulant activities of Lepirudin.
TiboloneTibolone may increase the anticoagulant activities of Lepirudin.
TicagrelorTicagrelor may increase the anticoagulant activities of Lepirudin.
TiclopidineTiclopidine may increase the anticoagulant activities of Lepirudin.
TinzaparinTinzaparin may increase the anticoagulant activities of Lepirudin.
TipranavirThe serum concentration of Lepirudin can be decreased when it is combined with Tipranavir.
TirofibanTirofiban may increase the anticoagulant activities of Lepirudin.
Tolfenamic AcidTolfenamic Acid may increase the anticoagulant activities of Lepirudin.
TolmetinTolmetin may increase the anticoagulant activities of Lepirudin.
TositumomabThe risk or severity of adverse effects can be increased when Lepirudin is combined with Tositumomab.
TranilastTranilast may increase the anticoagulant activities of Lepirudin.
TrapidilTrapidil may increase the anticoagulant activities of Lepirudin.
TreprostinilTreprostinil may increase the anticoagulant activities of Lepirudin.
TreprostinilThe risk or severity of adverse effects can be increased when Lepirudin is combined with Treprostinil.
TriazolamThe serum concentration of Triazolam can be increased when it is combined with Lepirudin.
TriflusalTriflusal may increase the anticoagulant activities of Lepirudin.
TrimipramineThe serum concentration of Trimipramine can be increased when it is combined with Lepirudin.
Trisalicylate-cholineTrisalicylate-choline may increase the anticoagulant activities of Lepirudin.
UrokinaseUrokinase may increase the anticoagulant activities of Lepirudin.
ValdecoxibValdecoxib may increase the anticoagulant activities of Lepirudin.
Vitamin EVitamin E may increase the anticoagulant activities of Lepirudin.
VorapaxarThe risk or severity of adverse effects can be increased when Vorapaxar is combined with Lepirudin.
WarfarinLepirudin may increase the anticoagulant activities of Warfarin.
XimelagatranLepirudin may increase the anticoagulant activities of Ximelagatran.
ZaltoprofenZaltoprofen may increase the anticoagulant activities of Lepirudin.
ZeranolZeranol may decrease the anticoagulant activities of Lepirudin.
ZidovudineThe serum concentration of Zidovudine can be decreased when it is combined with Lepirudin.
ZileutonZileuton may increase the anticoagulant activities of Lepirudin.
ZomepiracZomepirac may increase the anticoagulant activities of Lepirudin.
Food InteractionsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
inhibitor
General Function:
Thrombospondin receptor activity
Specific Function:
Thrombin, which cleaves bonds after Arg and Lys, converts fibrinogen to fibrin and activates factors V, VII, VIII, XIII, and, in complex with thrombomodulin, protein C. Functions in blood homeostasis, inflammation and wound healing.
Gene Name:
F2
Uniprot ID:
P00734
Molecular Weight:
70036.295 Da
References
  1. Turpie AG: Anticoagulants in acute coronary syndromes. Am J Cardiol. 1999 Sep 2;84(5A):2M-6M. [PubMed:10505536 ]
  2. Warkentin TE: Venous thromboembolism in heparin-induced thrombocytopenia. Curr Opin Pulm Med. 2000 Jul;6(4):343-51. [PubMed:10912644 ]
  3. Eriksson BI: New therapeutic options in deep vein thrombosis prophylaxis. Semin Hematol. 2000 Jul;37(3 Suppl 5):7-9. [PubMed:11055889 ]
  4. Fabrizio MC: Use of ecarin clotting time (ECT) with lepirudin therapy in heparin-induced thrombocytopenia and cardiopulmonary bypass. J Extra Corpor Technol. 2001 May;33(2):117-25. [PubMed:11467439 ]
  5. Szaba FM, Smiley ST: Roles for thrombin and fibrin(ogen) in cytokine/chemokine production and macrophage adhesion in vivo. Blood. 2002 Feb 1;99(3):1053-9. [PubMed:11807012 ]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23