Welcome to DrugBank 4.0! If you prefer, you can still go back to version 3.0.
Identification
NameThyrotropin Alfa
Accession NumberDB00024  (BIOD00020, BTD00020)
Typebiotech
Groupsapproved
Description

Thyrotropin alfa is a heterodimeric glycoprotein comprised of two non-covalently linked subunits, an alpha subunit of 92 amino acid residues containing two N-linked glycosylation sites and a beta subunit of 118 residues containing one N-linked glycosylation site. The amino acid sequence of thyrotropin alfa is identical to that of human pituitary thyroid stimulating hormone.

Protein structureDb00024
Protein chemical formulaC975H1513N267O304S26
Protein average weight22672.9000
Sequences
>Alpha chain
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC
VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Download FASTA Format
Synonyms
SynonymLanguageCode
Follicle-stimulating hormone beta subunitNot AvailableNot Available
Follitropin beta chain precursorNot AvailableNot Available
FSH-BNot AvailableNot Available
FSH-betaNot AvailableNot Available
SaltsNot Available
Brand names
NameCompany
ThyrogenGenzyme Inc
Brand mixturesNot Available
CategoriesNot Available
CAS number9002-71-5
Taxonomy
KingdomOrganic Compounds
SuperclassOrganic Acids
ClassCarboxylic Acids and Derivatives
SubclassAmino Acids, Peptides, and Analogues
Direct parentPeptides
Alternative parentsNot Available
SubstituentsNot Available
Classification descriptionNot Available
Pharmacology
IndicationFor detection of residueal or recurrent thyroid cancer
PharmacodynamicsBinding of thyrotropin alfa to TSH receptors on normal thyroid epithelial cells or on well-differentiated thyroid cancer tissue stimulates iodine uptake and organification. Thyrogen is an exogenous source of human TSH that offers an additional diagnostic tool in the follow-up of patients with a history of well-differentiated thyroid cancer.
Mechanism of actionThyrotropin Alfa binds to the thyrotropin receptors found on any residual thyroid cells or tissues. This stimulates radioactive iodine uptake for better radiodiagnostic imaging.
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
Metabolism
Route of eliminationNot Available
Half life5 +/- 10 hrs
ClearanceNot Available
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
ADMET
Predicted ADMET features
Property Value Probability
Human Intestinal Absorption Not Available Not Available
Blood Brain Barrier Not Available Not Available
Caco-2 permeable Not Available Not Available
P-glycoprotein substrate Not Available Not Available
P-glycoprotein inhibitor I Not Available Not Available
P-glycoprotein inhibitor II Not Available Not Available
Renal organic cation transporter Not Available Not Available
CYP450 2C9 substrate Not Available Not Available
CYP450 2D6 substrate Not Available Not Available
CYP450 3A4 substrate Not Available Not Available
CYP450 1A2 substrate Not Available Not Available
CYP450 2C9 substrate Not Available Not Available
CYP450 2D6 substrate Not Available Not Available
CYP450 2C19 substrate Not Available Not Available
CYP450 3A4 substrate Not Available Not Available
CYP450 inhibitory promiscuity Not Available Not Available
Ames test Not Available Not Available
Carcinogenicity Not Available Not Available
Biodegradation Not Available Not Available
Rat acute toxicity Not Available Not applicable
hERG inhibition (predictor I) Not Available Not Available
hERG inhibition (predictor II) Not Available Not Available
Pharmacoeconomics
Manufacturers
  • Sanofi aventis us llc
  • Genzyme corp
Packagers
Dosage forms
FormRouteStrength
Powder, for solutionIntramuscular
Prices
Unit descriptionCostUnit
Thyrogen 1.1 mg vial1196.4USDvial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
CountryPatent NumberApprovedExpires (estimated)
United States58405661995-11-242015-11-24
Properties
Stateliquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.330Not Available
isoelectric point7.50Not Available
Spectra
SpectraNot Available
References
Synthesis ReferenceNot Available
General ReferenceNot Available
External Links
ResourceLink
UniProtP01225
GenbankM16647
PharmGKBPA164746560
Drug Product Database2246016
RxListhttp://www.rxlist.com/cgi/generic2/thyrotropin.htm
Drugs.comhttp://www.drugs.com/cdi/thyrotropin-alfa.html
ATC CodesV04CJ01
AHFS Codes
  • 36:60.00
PDB Entries
FDA labelshow(2.27 MB)
MSDSNot Available
Interactions
Drug InteractionsSearched, but no interactions found.
Food InteractionsNot Available

1. Thyrotropin receptor

Kind: protein

Organism: Human

Pharmacological action: yes

Actions: agonist

Components

Name UniProt ID Details
Thyrotropin receptor P16473 Details

References:

  1. Szkudlinski MW: Recombinant human thyrotropins of the twenty-first century. Expert Opin Pharmacother. 2004 Dec;5(12):2435-40. Pubmed
  2. Conway GS: Clinical manifestations of genetic defects affecting gonadotrophins and their receptors. Clin Endocrinol (Oxf). 1996 Dec;45(6):657-63. Pubmed
  3. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. Pubmed

Comments
Drug created on June 13, 2005 07:24 / Updated on September 03, 2011 17:17