| Identification | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Name | Thyrotropin Alfa | ||||||||||||||
| Accession Number | DB00024 (BIOD00020, BTD00020) | ||||||||||||||
| Type | biotech | ||||||||||||||
| Groups | approved | ||||||||||||||
| Description | Thyrotropin alfa is a heterodimeric glycoprotein comprised of two non-covalently linked subunits, an alpha subunit of 92 amino acid residues containing two N-linked glycosylation sites and a beta subunit of 118 residues containing one N-linked glycosylation site. The amino acid sequence of thyrotropin alfa is identical to that of human pituitary thyroid stimulating hormone. |
||||||||||||||
| Protein structure |
Display: 3D Structure |
||||||||||||||
| Protein chemical formula | C975H1513N267O304S26 | ||||||||||||||
| Protein average weight | 22672.9000 | ||||||||||||||
| Sequences |
>Alpha chain APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS >Beta chain NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYET VRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE FASTA |
||||||||||||||
| Synonyms |
|
||||||||||||||
| Salts | Not Available | ||||||||||||||
| Brand names |
|
||||||||||||||
| Brand mixtures | Not Available | ||||||||||||||
| Categories |
|
||||||||||||||
| CAS number | 9002-71-5 | ||||||||||||||
| Taxonomy | |||||||||||||||
| Kingdom | Not Available | ||||||||||||||
| Classes | Not Available | ||||||||||||||
| Substructures | Not Available | ||||||||||||||
| Pharmacology | |||||||||||||||
| Indication | For detection of residueal or recurrent thyroid cancer | ||||||||||||||
| Pharmacodynamics | Binding of thyrotropin alfa to TSH receptors on normal thyroid epithelial cells or on well-differentiated thyroid cancer tissue stimulates iodine uptake and organification. Thyrogen is an exogenous source of human TSH that offers an additional diagnostic tool in the follow-up of patients with a history of well-differentiated thyroid cancer. | ||||||||||||||
| Mechanism of action | Thyrotropin Alfa binds to the thyrotropin receptors found on any residual thyroid cells or tissues. This stimulates radioactive iodine uptake for better radiodiagnostic imaging. | ||||||||||||||
| Absorption | Not Available | ||||||||||||||
| Volume of distribution | Not Available | ||||||||||||||
| Protein binding | Not Available | ||||||||||||||
| Metabolism | Not Available | ||||||||||||||
| Route of elimination | Not Available | ||||||||||||||
| Half life | 5 +/- 10 hrs | ||||||||||||||
| Clearance | Not Available | ||||||||||||||
| Toxicity | Not Available | ||||||||||||||
| Affected organisms |
|
||||||||||||||
| Pathways | Not Available | ||||||||||||||
| Pharmacoeconomics | |||||||||||||||
| Manufacturers |
|
||||||||||||||
| Packagers | |||||||||||||||
| Dosage forms |
|
||||||||||||||
| Prices |
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational
purposes only.
|
||||||||||||||
| Patents |
|
||||||||||||||
| Properties | |||||||||||||||
| State | liquid | ||||||||||||||
| Experimental Properties |
|
||||||||||||||
| References | |||||||||||||||
| Synthesis Reference | Not Available | ||||||||||||||
| General Reference | Not Available | ||||||||||||||
| External Links |
|
||||||||||||||
| ATC Codes |
|
||||||||||||||
| AHFS Codes |
|
||||||||||||||
| PDB Entries | |||||||||||||||
| FDA label | show (2.27 MB) | ||||||||||||||
| MSDS | Not Available | ||||||||||||||
| Interactions | |||||||||||||||
| Drug Interactions | Searched, but no interactions found. | ||||||||||||||
| Food Interactions | Not Available | ||||||||||||||
| Targets |
|---|
|
Pharmacological action: yes
Actions: agonist Receptor for thyrothropin. Plays a central role in controlling thyroid cell metabolism. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Also acts as a receptor for thyrostimulin (GPA2+GPB5) Organism class: humanUniProt ID: P16473 ![]() Gene: TSHR ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References:
|
| Comments |
|---|