You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameThyrotropin Alfa
Accession NumberDB00024  (BIOD00020, BTD00020)
Typebiotech
Groupsapproved
Description

Thyrotropin alfa is a recombinant form of thyroid stimulating hormone used in performing certain tests in patients who have or have had thyroid cancer. It is also used along with a radioactive agent to destroy remaining thyroid tissue in certain patients who have had their thyroid gland removed because of thyroid cancer. It is a heterodimeric glycoprotein comprised of two non-covalently linked subunits, an alpha subunit of 92 amino acid residues containing two N-linked glycosylation sites and a beta subunit of 112 residues containing one N-linked glycosylation site. The alpha subunit is nearly identical to that of human chorionic gonadotropin (hCG), luteinizing hormone (LH), and follicle-stimulating hormone (FSH). The alpha subunit is thought to be the effector region responsible for stimulation of adenylate cyclase (involved the generation of cAMP). The beta subunit (TSHB) is unique to TSH, and therefore determines its receptor specificity. The amino acid sequence of thyrotropin alfa is identical to that of human pituitary thyroid stimulating hormone.

Protein structureDb00024
Protein chemical formulaC975H1513N267O304S26
Protein average weight22672.9000
Sequences
>Alpha chain
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC
VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
>Beta chain
FCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKLFLPKYALSQDVCTYRDFIYR
TVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAIKTNYCTKPQKSY
Download FASTA Format
Synonyms
SynonymLanguageCode
rTSHNot AvailableNot Available
Thyroid stimulating hormoneNot AvailableNot Available
Thyrotrophin-alfaNot AvailableNot Available
Thyrotrophin-alphaNot AvailableNot Available
ThyrotropinNot AvailableNot Available
Thyrotropin-aNot AvailableNot Available
Thyrotropin-alphaNot AvailableNot Available
ThytrophinNot AvailableNot Available
TSHNot AvailableNot Available
SaltsNot Available
Brand names
NameCompany
ThyrogenGenzyme Inc
Brand mixturesNot Available
Categories
CAS number9002-71-5
Taxonomy
KingdomOrganic Compounds
SuperclassOrganic Acids
ClassCarboxylic Acids and Derivatives
SubclassAmino Acids, Peptides, and Analogues
Direct parentPeptides
Alternative parentsNot Available
SubstituentsNot Available
Classification descriptionNot Available
Pharmacology
IndicationFor detection of residueal or recurrent thyroid cancer
PharmacodynamicsBinding of thyrotropin alfa to TSH receptors on normal thyroid epithelial cells or on well-differentiated thyroid cancer tissue stimulates iodine uptake and organification. Thyrogen is an exogenous source of human TSH that offers an additional diagnostic tool in the follow-up of patients with a history of well-differentiated thyroid cancer.
Mechanism of actionThyrotropin Alfa binds to the thyrotropin receptors found on any residual thyroid cells or tissues. This stimulates radioactive iodine uptake for better radiodiagnostic imaging.
AbsorptionTime to peak: Median: 10 hours (range: 3-24 hours) After a single intramuscular injection of 0.9 mg of thyrotropin alfa: Cmax= 116+38mU/L, Tmax=22+8.5 hours. AUC=5088+1728 mU·hr/L.
Volume of distributionNot Available
Protein bindingNot Available
Metabolism
Route of eliminationkidney and liver
Half life25 ± 10 hours
ClearanceNot Available
ToxicityNo difference in efficacy and toxicity between adult and geriatric patients. No studies in lactating women, pregnant women and pediatrics. Cautionary administration is advised.
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
Manufacturers
  • Sanofi aventis us llc
  • Genzyme corp
Packagers
Dosage forms
FormRouteStrength
Powder, for solutionIntramuscular
Prices
Unit descriptionCostUnit
Thyrogen 1.1 mg vial1196.4USDvial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
CountryPatent NumberApprovedExpires (estimated)
United States58405661995-11-242015-11-24
Properties
Stateliquid
Experimental Properties
PropertyValueSource
melting point55 °CNot Available
hydrophobicity-0.330Not Available
isoelectric point7.50Not Available
References
Synthesis Reference

19366632

General Reference
  1. Lexicomp
    #Product label
External Links
ResourceLink
UniProtP01225
GenbankM16647
PharmGKBPA164746560
Drug Product Database2246016
RxListhttp://www.rxlist.com/cgi/generic2/thyrotropin.htm
Drugs.comhttp://www.drugs.com/cdi/thyrotropin-alfa.html
ATC CodesV04CJ01
AHFS Codes
  • 36:60.00
PDB Entries
FDA labelshow(2.27 MB)
MSDSNot Available
Interactions
Drug InteractionsSearched, but no interactions found.
Food InteractionsNot Available

Targets

1. Thyrotropin receptor

Kind: protein

Organism: Human

Pharmacological action: yes

Actions: agonist

Components

Name UniProt ID Details
Thyrotropin receptor P16473 Details

References:

  1. Szkudlinski MW: Recombinant human thyrotropins of the twenty-first century. Expert Opin Pharmacother. 2004 Dec;5(12):2435-40. Pubmed
  2. Conway GS: Clinical manifestations of genetic defects affecting gonadotrophins and their receptors. Clin Endocrinol (Oxf). 1996 Dec;45(6):657-63. Pubmed
  3. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. Pubmed

Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on October 14, 2014 17:27