You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameAnistreplase
Accession NumberDB00029  (BIOD00102, BTD00102)
TypeBiotech
GroupsApproved
Description

Human tissue plasminogen activator, purified, glycosylated, 527 residues purified from CHO cells. Eminase is a lyophilized (freeze-dried) formulation of anistreplase, the p-anisoyl derivative of the primary Lys-plasminogen-streptokinase activator complex (a complex of Lys-plasminogen and streptokinase). A p-anisoyl group is chemically conjugated to a complex of bacterial-derived streptokinase and human Plasma-derived Lys-plasminogen proteins.

Protein structureDb00029
Protein chemical formulaC2569H3928N746O781S40
Protein average weight59042.3000
Sequences
>DB00029 sequence
SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGG
TCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWSTAESGAECTNWNSSA
LAQKPYSGRRPDAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDC
YFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAK
PWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRS
PGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVH
KEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEAL
SPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGG
PLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP
Download FASTA Format
Synonyms
SynonymLanguageCode
t- PANot AvailableNot Available
t-plasminogen activatorNot AvailableNot Available
Tissue-type plasminogen activator precursorNot AvailableNot Available
tPANot AvailableNot Available
Prescription ProductsNot Available
Generic Prescription ProductsNot Available
Over the Counter ProductsNot Available
International Brands
NameCompany
EminaseWulfing Pharma GmbH
Brand mixturesNot Available
SaltsNot Available
Categories
CAS number81669-57-0
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationFor lysis of acute pulmonary emboli, intracoronary emboli and management of myocardial infarction
PharmacodynamicsAnistreplase cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction.
Mechanism of actionAnistreplase cleaves the Arg/Val bond in plasminogen to form plasmin. This in turn leads to the degradation of blood clots.
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
MetabolismNot Available
Route of eliminationNot Available
Half lifeNot Available
ClearanceNot Available
ToxicityNot Available
Affected organisms
  • Humans and other mammals
Pathways
PathwayCategorySMPDB ID
Anistreplase Action PathwayDrug actionSMP00281
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage formsNot Available
PricesNot Available
PatentsNot Available
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point60 °CNovokhatny, V.V. et al., J. Biol. Chem. 266:12994-123002 (1991)
hydrophobicity-0.516Not Available
isoelectric point7.61Not Available
References
Synthesis ReferenceNot Available
General ReferenceNot Available
External Links
ATC CodesB01AD03
AHFS Codes
  • 20:12.20
PDB Entries
FDA labelNot Available
MSDSNot Available
Interactions
Drug Interactions
Drug
AbciximabAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
AcenocoumarolMay enhance the anticoagulant effect of Anticoagulants.
Acetylsalicylic acidAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
Aminosalicylic AcidSalicylates may enhance the adverse/toxic effect of Thrombolytic Agents. An increased risk of bleeding may occur.
AnagrelideAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
ApixabanMay enhance the anticoagulant effect of Anticoagulants.
AprotininAprotinin may diminish the therapeutic effect of Thrombolytic Agents.
ArgatrobanMay enhance the anticoagulant effect of Anticoagulants.
Bismuth SubsalicylateSalicylates may enhance the adverse/toxic effect of Thrombolytic Agents. An increased risk of bleeding may occur.
BivalirudinMay enhance the anticoagulant effect of Anticoagulants.
CilostazolAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
CitalopramAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
ClopidogrelAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
Dabigatran etexilateMay enhance the anticoagulant effect of Dabigatran Etexilate.
DalteparinMay enhance the anticoagulant effect of Anticoagulants.
DanaparoidMay enhance the anticoagulant effect of Anticoagulants.
DesvenlafaxineAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
DiflunisalAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
DipyridamoleAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
DuloxetineAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
EnoxaparinMay enhance the anticoagulant effect of Anticoagulants.
EpoprostenolMay enhance the adverse/toxic effect of Prostacyclin Analogues. Specifically, the antiplatelet effects of prostacyclin analogues may lead to an increased risk of bleeding when combined with thrombolytic agents.
EptifibatideAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
EscitalopramAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
EtodolacAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
FenoprofenAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
FloctafenineAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
FluoxetineAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
FluvoxamineAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
Fondaparinux sodiumMay enhance the anticoagulant effect of Anticoagulants.
HeparinMay enhance the anticoagulant effect of Anticoagulants.
IbuprofenAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
IloprostMay enhance the adverse/toxic effect of Prostacyclin Analogues. Specifically, the antiplatelet effects of prostacyclin analogues may lead to an increased risk of bleeding when combined with thrombolytic agents.
IndomethacinAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
KetoprofenAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
KetorolacAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
LevomilnacipranAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
Magnesium salicylateSalicylates may enhance the adverse/toxic effect of Thrombolytic Agents. An increased risk of bleeding may occur.
Mefenamic acidAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
MeloxicamAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
MilnacipranAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
NabumetoneAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
NadroparinMay enhance the anticoagulant effect of Anticoagulants.
NaproxenAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
OxaprozinAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
ParoxetineAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
PiroxicamAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
PrasugrelAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
RivaroxabanMay enhance the anticoagulant effect of Anticoagulants.
SalsalateSalicylates may enhance the adverse/toxic effect of Thrombolytic Agents. An increased risk of bleeding may occur.
SertralineAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
SulindacAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
Tiaprofenic acidAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
TicagrelorAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
TiclopidineAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
TinzaparinMay enhance the anticoagulant effect of Anticoagulants.
TirofibanAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
TolmetinAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
TreprostinilMay enhance the adverse/toxic effect of Prostacyclin Analogues. Specifically, the antiplatelet effects of prostacyclin analogues may lead to an increased risk of bleeding when combined with thrombolytic agents.
VenlafaxineAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
VilazodoneAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
VorapaxarAgents with Antiplatelet Properties may enhance the anticoagulant effect of Thrombolytic Agents.
Food InteractionsNot Available

Targets

1. Plasminogen

Kind: protein

Organism: Human

Pharmacological action: yes

Actions: activator

Components

Name UniProt ID Details
Plasminogen P00747 Details

References:

  1. Longstaff C, Williams S, Thelwell C: Fibrin binding and the regulation of plasminogen activators during thrombolytic therapy. Cardiovasc Hematol Agents Med Chem. 2008 Jul;6(3):212-23. Pubmed
  2. Melandri G, Vagnarelli F, Calabrese D, Semprini F, Nanni S, Branzi A: Review of tenecteplase (TNKase) in the treatment of acute myocardial infarction. Vasc Health Risk Manag. 2009;5(1):249-56. Epub 2009 Apr 8. Pubmed
  3. Hilleman DE, Tsikouris JP, Seals AA, Marmur JD: Fibrinolytic agents for the management of ST-segment elevation myocardial infarction. Pharmacotherapy. 2007 Nov;27(11):1558-70. Pubmed
  4. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. Pubmed

2. Fibrinogen alpha chain

Kind: protein

Organism: Human

Pharmacological action: yes

Components

Name UniProt ID Details
Fibrinogen alpha chain P02671 Details

References:

  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed

3. Urokinase plasminogen activator surface receptor

Kind: protein

Organism: Human

Pharmacological action: unknown

Components

Name UniProt ID Details
Urokinase plasminogen activator surface receptor Q03405 Details

References:

  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed

4. Plasminogen activator inhibitor 1

Kind: protein

Organism: Human

Pharmacological action: unknown

Components

Name UniProt ID Details
Plasminogen activator inhibitor 1 P05121 Details

References:

  1. Hilleman DE, Tsikouris JP, Seals AA, Marmur JD: Fibrinolytic agents for the management of ST-segment elevation myocardial infarction. Pharmacotherapy. 2007 Nov;27(11):1558-70. Pubmed

Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on September 29, 2010 14:34