| Identification | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Name | Anistreplase | ||||||||||||
| Accession Number | DB00029 (BIOD00102, BTD00102) | ||||||||||||
| Type | biotech | ||||||||||||
| Groups | approved | ||||||||||||
| Description | Human tissue plasminogen activator, purified, glycosylated, 527 residues purified from CHO cells. Eminase is a lyophilized (freeze-dried) formulation of anistreplase, the p-anisoyl derivative of the primary Lys-plasminogen-streptokinase activator complex (a complex of Lys-plasminogen and streptokinase). A p-anisoyl group is chemically conjugated to a complex of bacterial-derived streptokinase and human Plasma-derived Lys-plasminogen proteins. |
||||||||||||
| Protein structure |
Display: 3D Structure |
||||||||||||
| Protein chemical formula | C2569H3928N746O781S40 | ||||||||||||
| Protein average weight | 59042.3000 | ||||||||||||
| Sequences |
>DB00029 sequence SYQVICRDEKTQMIYQQHQSWLRPVLRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGG TCQQALYFSDFVCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWSTAESGAECTNWNSSA LAQKPYSGRRPDAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDC YFGNGSAYRGTHSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAK PWCHVLKNRRLTWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRS PGERFLCGGILISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVH KEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEAL SPFYSERLKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGG PLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP FASTA |
||||||||||||
| Synonyms |
|
||||||||||||
| Salts | Not Available | ||||||||||||
| Brand names |
|
||||||||||||
| Brand mixtures | Not Available | ||||||||||||
| Categories |
|
||||||||||||
| CAS number | 81669-57-0 | ||||||||||||
| Taxonomy | |||||||||||||
| Kingdom | Not Available | ||||||||||||
| Classes | Not Available | ||||||||||||
| Substructures | Not Available | ||||||||||||
| Pharmacology | |||||||||||||
| Indication | For lysis of acute pulmonary emboli, intracoronary emboli and management of myocardial infarction | ||||||||||||
| Pharmacodynamics | Anistreplase cleaves the Arg/Val bond in plasminogen to form plasmin. Plasmin in turn degrades the fibrin matrix of the thrombus, thereby exerting its thrombolytic action. This helps eliminate blood clots or arterial blockages that cause myocardial infarction. | ||||||||||||
| Mechanism of action | Anistreplase cleaves the Arg/Val bond in plasminogen to form plasmin. This in turn leads to the degradation of blood clots. | ||||||||||||
| Absorption | Not Available | ||||||||||||
| Volume of distribution | Not Available | ||||||||||||
| Protein binding | Not Available | ||||||||||||
| Metabolism | Not Available | ||||||||||||
| Route of elimination | Not Available | ||||||||||||
| Half life | Not Available | ||||||||||||
| Clearance | Not Available | ||||||||||||
| Toxicity | Not Available | ||||||||||||
| Affected organisms |
|
||||||||||||
| Pathways |
|
||||||||||||
| Pharmacoeconomics | |||||||||||||
| Manufacturers | Not Available | ||||||||||||
| Packagers | |||||||||||||
| Dosage forms |
|
||||||||||||
| Prices | Not Available | ||||||||||||
| Patents | Not Available | ||||||||||||
| Properties | |||||||||||||
| State | liquid | ||||||||||||
| Experimental Properties |
|
||||||||||||
| References | |||||||||||||
| Synthesis Reference | Not Available | ||||||||||||
| General Reference | Not Available | ||||||||||||
| External Links |
|
||||||||||||
| ATC Codes |
|
||||||||||||
| AHFS Codes |
|
||||||||||||
| PDB Entries | |||||||||||||
| FDA label | Not Available | ||||||||||||
| MSDS | Not Available | ||||||||||||
| Interactions | |||||||||||||
| Drug Interactions | Not Available | ||||||||||||
| Food Interactions | Not Available | ||||||||||||
| Targets |
|---|
|
1. Plasminogen Pharmacological action: yesActions: activator Angiostatin is an angiogenesis inhibitor that blocks neovascularization and growth of experimental primary and metastatic tumors in vivo Organism class: humanUniProt ID: P00747 ![]() Gene: PLG ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References:
Pharmacological action: yes
Fibrinogen has a double function:yielding monomers that polymerize into fibrin and acting as a cofactor in platelet aggregation Organism class: humanUniProt ID: P02671 ![]() Gene: FGA ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References: 3. Urokinase plasminogen activator surface receptor Pharmacological action: unknownActs as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. It is subject to negative-feedback regulation by U-PA which cleaves it into an inactive form Organism class: humanUniProt ID: Q03405 ![]() Gene: PLAUR ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References: 4. Plasminogen activator inhibitor 1 Pharmacological action: unknownThis inhibitor acts as 'bait' for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis Organism class: humanUniProt ID: P05121 ![]() Gene: SERPINE1 ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References:
|
| Comments |
|---|