Banner
Identification
Name Insulin recombinant
Accession Number DB00030 (BIOD00105, BTD00105)
Type biotech
Groups approved
Description

Insulin is a 51 residue peptide hormone, composed of two amino acid chains covalently linked by disulfide bonds. Recombinant insulin is synthesized by inserting the human insulin gene into E. coli, which then produces insulin for human use.

Protein structure Db00030
Display: 3D Structure
Protein chemical formula C257H387N65O76S6
Protein average weight 5795.6000
Sequences
>A chain
GIVEQCCTSICSLYQLENYCN

>B chain
FVNQHLCGSHLVEALYLVCGERGFFYTPKT

FASTA
Synonyms
  • Insulin precursor
Brand names
  • Novolin R (Novo Nordisk)
Brand name mixtures Not Available
Categories
  • Hypoglycemic Agents
CAS number 9004-10-8
Taxonomy
Kingdom Not Available
Classes Not Available
Substructures Not Available
Pharmacology
Indication For treatment of Type I and II diabetes mellitus.
Pharmacodynamics Used in the treatment of type I and type II diabetes, the primary activity of insulin is the regulation of glucose metabolism. Insulin promotes glucose and amino acid uptake into muscle and adipose tissues, and other tissues except brain and liver. It also has an anabolic role in stimulating glycogen, fatty acid, and protein synthesis. Insulin inhibits gluconeogenesis in the liver.
Mechanism of action Insulin binds to the insulin receptor (IR), a heterotetrameric protein consisting of two extracellular alpha units and two transmembrane beta units. The binding of insulin to the alpha subunit of IR stimulates the tyrosine kinase activity intrinsic to the beta subunit of the receptor. The bound receptor is able to autophosphorylate and phosphorylate numerous intracellular substrates such as insulin receptor substrates (IRS) proteins, Cbl, APS, Shc and Gab 1. These activated proteins, in turn, lead to the activation of downstream signaling molecules including PI3 kinase and Akt. Akt regulates the activity of glucose transporter 4 (GLUT4) and protein kinase C (PKC) which play a critical role in metabolism and catabolism.
Absorption Not Available
Volume of distribution Not Available
Protein binding Not Available
Metabolism

Insulin is predominantly cleared by metabolic degradation via a receptor-mediated process.

Route of elimination Not Available
Half life Not Available
Clearance Not Available
Toxicity Not Available
Affected organisms
  • Humans and other mammals
Pathways Not Available
Pharmacoeconomics
Manufacturers
  • Novo nordisk inc
Packagers
Dosage forms
Form Route Strength
Liquid Intramuscular
Liquid Intravenous
Liquid Oral
Liquid Subcutaneous
Solution Intravenous
Solution Subcutaneous
Suspension Intramuscular
Suspension Subcutaneous
Prices
Unit description Cost Unit
NovoLIN R PenFill 100 unit/ml Solution Five 3ml Cartridges Per Box = 15ml 162.26 USD cartridge
NovoLIN R 100 unit/ml Solution 10ml Vial 73.19 USD vial
Novolin r 100 unit/ml cartridg 33.33 USD ml
NovoLIN R InnoLet 100 unit/ml Solution 3ml Cartridge 24.17 USD cartridge
Humulin N Cartridge 100 unit/ml Cartridge 2.99 USD cartridge
Humulin R Cartridge 100 unit/ml Cartridge 2.99 USD cartridge
Novolin Ge Toronto Penfill 100 unit/ml Cartridge 2.8 USD cartridge
Novolin Ge Nph Penfill 100 unit/ml Cartridge 2.78 USD cartridge
Humulin N 100 unit/ml 2.29 USD cartridge
Humulin R 100 unit/ml 2.29 USD cartridge
Novolin Ge Nph 100 unit/ml 2.14 USD cartridge
Novolin Ge Toronto 100 unit/ml 2.14 USD cartridge
Patents Not Available
Properties
State liquid
Melting point 81 oC (Khachidze, D.G. et al., J. Biol. Phys. Chem. 1:64-67 (2001))
Experimental Properties
Property Value Source
hydrophobicity 0.218 PhysProp
isoelectric point 5.39 Various sources
References
Synthesis Reference Not Available
General Reference Not Available
External Links
Resource Link
UniProt Q8HXV2 Link_out
Genbank AY137503 Link_out
Drug Product Database 795879 Link_out
RxList http://www.rxlist.com/cgi/generic3/novolog.htm Link_out
ATC Codes
  • A10AB01
  • A10AE05
  • A10AB04
  • A10AE04
  • A10AD05
  • A10AC03
  • A10AC01
  • A10AB05
  • A10AB03
AHFS Codes
  • 68:20.08
  • 92:02.00*
PDB Entries
FDA label show (133.1 KB)
MSDS Not Available
Interactions
Drug Interactions
Drug Interaction
Food Interactions Not Available
Targets

1. Insulin receptor

Pharmacological action: yes
Actions: agonist

This receptor binds insulin and has a tyrosine-protein kinase activity. Isoform Short has a higher affinity for insulin. Mediates the metabolic functions of insulin. Binding to insulin stimulates association of the receptor with downstream mediators including IRS1 and phosphatidylinositol 3'-kinase (PI3K). Can activate PI3K either directly by binding to the p85 regulatory subunit, or indirectly via IRS1

Organism class: human
UniProt ID: P06213 Link_out
Gene: INSR Link_out
Protein Sequence: FASTA
Gene Sequence: FASTA
SNPs: SNPJam Report Link_out

References:
  1. Desbuquois B, Chauvet G, Kouach M, Authier F: Cell itinerary and metabolic fate of proinsulin in rat liver: in vivo and in vitro studies. Endocrinology. 2003 Dec;144(12):5308-21. Epub 2003 Sep 11. Pubmed
  2. Chen LM, Yang XW, Tang JG: Acidic residues on the N-terminus of proinsulin C-Peptide are important for the folding of insulin precursor. J Biochem (Tokyo). 2002 Jun;131(6):855-9. Pubmed
  3. Bell DS: Insulin therapy in diabetes mellitus: how can the currently available injectable insulins be most prudently and efficaciously utilised? Drugs. 2007;67(13):1813-27. Pubmed
  4. Tanti JF, Jager J: Cellular mechanisms of insulin resistance: role of stress-regulated serine kinases and insulin receptor substrates (IRS) serine phosphorylation. Curr Opin Pharmacol. 2009 Dec;9(6):753-62. Epub 2009 Aug 13. Pubmed
  5. Chiu SL, Cline HT: Insulin receptor signaling in the development of neuronal structure and function. Neural Dev. 2010 Mar 15;5:7. Pubmed
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. Pubmed

2. Insulin-like growth factor 1 receptor

Pharmacological action: unknown

This receptor binds insulin-like growth factor 1 (IGF1) with a high affinity and IGF2 with a lower affinity. It has a tyrosine-protein kinase activity, which is necessary for the activation of the IGF1-stimulated downstream signaling cascade

Organism class: human
UniProt ID: P08069 Link_out
Gene: IGF1R Link_out
Protein Sequence: FASTA
Gene Sequence: FASTA
SNPs: SNPJam Report Link_out

References:
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed

3. Retinoblastoma-associated protein

Pharmacological action: unknown

Key regulator of entry into cell division that acts as a tumor suppressor. Directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. Recruits and targets histone methyltransferases SUV39H1, SUV420H1 and SUV420H2, leading to epigenetic transcriptional repression. Controls histone H4 'Lys-20' trimethylation. Also acts as a transcription repressor of E2F target genes by recruiting chromatin-modifying enzymes to promoters. Inhibits the intrinsic kinase activity of TAF1. Forms a complex with adenovirus E1A and with SV40 large T antigen. May bind and modulate functionally certain cellular proteins with which T and E1A compete for pocket binding

Organism class: human
UniProt ID: P06400 Link_out
Gene: RB1 Link_out
Protein Sequence: FASTA
Gene Sequence: FASTA
SNPs: SNPJam Report Link_out

References:
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed

4. Cathepsin D

Pharmacological action: unknown

Acid protease active in intracellular protein breakdown. Involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease

Organism class: human
UniProt ID: P07339 Link_out
Gene: CTSD Link_out
Protein Sequence: FASTA
Gene Sequence: FASTA
SNPs: SNPJam Report Link_out

References:
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed

5. Insulin-degrading enzyme

Pharmacological action: unknown

May play a role in the cellular processing of insulin. May be involved in intercellular peptide signaling

Organism class: human
UniProt ID: P14735 Link_out
Gene: IDE Link_out
Protein Sequence: FASTA
Gene Sequence: FASTA
SNPs: SNPJam Report Link_out

References:
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed

6. Neuroendocrine convertase 2

Pharmacological action: unknown

Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues

Organism class: human
UniProt ID: P16519 Link_out
Gene: PCSK2 Link_out
Protein Sequence: FASTA
Gene Sequence: FASTA
SNPs: SNPJam Report Link_out

References:
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed

7. Carboxypeptidase E

Pharmacological action: unknown

Removes residual C-terminal Arg or Lys remaining after initial endoprotease cleavage during prohormone processing. Processes proinsulin

Organism class: human
UniProt ID: P16870 Link_out
Gene: CPE Link_out
Protein Sequence: FASTA
Gene Sequence: FASTA
SNPs: SNPJam Report Link_out

References:
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed

8. Neuroendocrine convertase 1

Pharmacological action: unknown

Involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Substrates include POMC, renin, enkephalin, dynorphin, somatostatin and insulin

Organism class: human
UniProt ID: P29120 Link_out
Gene: PCSK1 Link_out
Protein Sequence: FASTA
Gene Sequence: FASTA
SNPs: SNPJam Report Link_out

References:
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed

9. Protein NOV homolog

Pharmacological action: unknown

Immediate-early protein likely to play a role in cell growth regulation

Organism class: human
UniProt ID: P48745 Link_out
Gene: NOV Link_out
Protein Sequence: FASTA
Gene Sequence: FASTA
SNPs: SNPJam Report Link_out

References:
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed

10. Low-density lipoprotein receptor-related protein 2

Pharmacological action: unknown

May participate in regulation of parathyroid-hormone and para-thyroid-hormone-related protein release

Organism class: human
UniProt ID: P98164 Link_out
Gene: LRP2 Link_out
Protein Sequence: FASTA
Gene Sequence: FASTA
SNPs: SNPJam Report Link_out

References:
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed

11. Insulin-like growth factor-binding protein 7

Pharmacological action: unknown

Binds IGF-I and IGF-II with a relatively low affinity. Stimulates prostacyclin (PGI2) production

Organism class: human
UniProt ID: Q16270 Link_out
Gene: IGFBP7 Link_out
Protein Sequence: FASTA
Gene Sequence: FASTA
SNPs: SNPJam Report Link_out

References:
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed

12. Synaptotagmin-like protein 4

Pharmacological action: unknown

Modulates exocytosis of dense-core granules and secretion of hormones in the pancreas and the pituitary. Interacts with vesicles containing negatively charged phospholipids in a Ca(2+)-independent manner

Organism class: human
UniProt ID: Q96C24 Link_out
Gene: SYTL4 Link_out
Protein Sequence: FASTA
Gene Sequence: FASTA
SNPs: SNPJam Report Link_out

References:
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. Pubmed
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. Pubmed

Enzymes

1. Cytochrome P450 1A2

Actions: inducer

Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Most active in catalyzing 2-hydroxylation. Caffeine is metabolized primarily by cytochrome CYP1A2 in the liver through an initial N3-demethylation. Also acts in the metabolism of aflatoxin B1 and acetaminophen

UniProt ID: P05177 Link_out
Gene: CYP1A2
Protein Sequence: FASTA
Gene Sequence: FASTA
SNPs: SNPJam Report Link_out

References:
  1. Flockhart DA. Drug Interactions: Cytochrome P450 Drug Interaction Table. Indiana University School of Medicine (2007). Accessed May 28, 2010.

Comments
Drug created on June 13, 2005 07:24 / Updated on September 29, 2010 14:34

This project is supported by Genome Alberta & Genome Canada, a not-for-profit organization that is leading Canada's national genomics strategy with $600 million in funding from the federal government. This project is also supported in part by GenomeQuest, Inc., an enterprise genomic information company serving the life science community.