You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameInsulin Lispro
Accession NumberDB00046  (BTD00065, BIOD00065, DB01310)
TypeBiotech
GroupsApproved
DescriptionInsulin lispro is a recombinant human insulin analogue produced in a specialized laboratory strain of Escherischia coli. Plasmid DNA transfected into the bacteria encodes for an analogue of human insulin that has a lysine at residuce B28 and proline at B29; these residues are reversed in endogenous human insulin. Reversal of these amino acid residues produces a rapid-acting insulin analogue. FDA approved on 1996.
Protein structureDb00046
Related Articles
Protein chemical formulaC257H387N65O76S6
Protein average weight5808.0 Da
Sequences
>A chain
GIVEQCCTSICSLYQLENYCN
>B chain
FVNQHLCGSHLVEALYLVCGERGFFYTKPT
Download FASTA Format
Synonyms
Insulin lispro protamine recombinant
Insulin Lispro Recombinant
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
HumalogSolution for injection100 U/mlSubcutaneous or intravenous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
HumalogSolution for injection100 U/mlSubcutaneous or intravenous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
HumalogSolution for injection100 U/mlSubcutaneous or intravenous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
HumalogSolution for injection100 U/mlSubcutaneous or intravenous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalogsolution100 unitintramuscular; intravenous; subcutaneousEli Lilly Canada Inc1996-11-15Not applicableCanada
HumalogSolution for injection100 U/mlSubcutaneous or intravenous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog (cartridge)solution100 unitintramuscular; intravenous; subcutaneousEli Lilly Canada Inc1996-11-27Not applicableCanada
Humalog (kwikpen)solution100 unitintramuscular; intravenous; subcutaneousEli Lilly Canada Inc2013-08-14Not applicableCanada
Humalog 200 Units/ml Kwikpensolution200 unitsubcutaneousEli Lilly Canada Inc2015-09-14Not applicableCanada
Humalog BasalSuspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog BasalSuspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Basal KwikpenSuspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Basal KwikpenSuspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog KwikpenSolution for injection100 U/mlSubcutaneous or intravenous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog KwikpenSolution for injection200 U/mlSubcutaneous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog KwikpenSolution for injection100 U/mlSubcutaneous or intravenous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog KwikpenSolution for injection200 U/mlSubcutaneous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog KwikpenSolution for injection200 U/mlSubcutaneous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog KwikpenSolution for injection200 U/mlSubcutaneous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Mix25Suspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Mix25Suspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Mix25Suspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Mix25 KwikpenSuspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Mix25 KwikpenSuspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Mix50Suspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Mix50Suspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Mix50Suspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Mix50 KwikpenSuspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Mix50 KwikpenSuspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.1996-04-30Not applicableEu
Humalog Mix50/50injection, suspension100 [iU]/mLsubcutaneousEli Lilly and Company2006-02-07Not applicableUs
Humalog Mix50/50 Kwikpeninjection, suspension100 [iU]/mLsubcutaneousEli Lilly and Company2006-02-07Not applicableUs
Humalog Mix75/25injection, suspension100 [iU]/mLsubcutaneousEli Lilly and Company1999-12-22Not applicableUs
Humalog Mix75/25injection, suspension100 [iU]/mLsubcutaneousPhysicians Total Care, Inc.2005-02-22Not applicableUs
Humalog Mix75/25 Kwikpeninjection, suspension100 [iU]/mLsubcutaneousEli Lilly and Company2008-01-16Not applicableUs
Humalog Penliquid100 unitintramuscular; intravenous; subcutaneousEli Lilly Canada Inc2000-01-102011-04-29Canada
LiprologSolution for injection100 U/mlSubcutaneous or intravenous useEli Lilly Nederland B.V.2001-08-01Not applicableEu
LiprologSolution for injection100 U/mlSubcutaneous or intravenous useEli Lilly Nederland B.V.2001-08-01Not applicableEu
LiprologSolution for injection100 U/mlSubcutaneous or intravenous useEli Lilly Nederland B.V.2001-08-01Not applicableEu
LiprologSolution for injection100 U/mlSubcutaneous or intravenous useEli Lilly Nederland B.V.2001-08-01Not applicableEu
LiprologSolution for injection100 U/mlSubcutaneous or intravenous useEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog BasalSuspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog BasalSuspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog Basal KwikpenSuspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog Basal KwikpenSuspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog KwikpenSolution for injection200 U/mlSubcutaneous useEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog KwikpenSolution for injection200 U/mlSubcutaneous useEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog KwikpenSolution for injection100 U/mlSubcutaneous or intravenous useEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog KwikpenSolution for injection100 U/mlSubcutaneous or intravenous useEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog Mix25Suspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog Mix25Suspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog Mix25 KwikpenSuspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog Mix25 KwikpenSuspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog Mix50Suspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog Mix50Suspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog Mix50 KwikpenSuspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.2001-08-01Not applicableEu
Liprolog Mix50 KwikpenSuspension for injection100 U/mlSubcutaneous useEli Lilly Nederland B.V.2001-08-01Not applicableEu
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNIIGFX7QIS1II
CAS number133107-64-9
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationFor the treatment of Type 1 or 2 diabetes mellitus. To be used in conjunction with an intermediate or long-acting insulin except when used in a continuous insulin infusion pump.
PharmacodynamicsInsulin is a natural hormone produced by beta cells of the pancreas. In non-diabetic individuals, a basal level of insulin is supplemented with insulin spikes following meals. Increased insulin secretion following meals is responsible for the metabolic changes that occur as the body transitions from a postabsorptive to absorptive state. Insulin promotes cellular uptake of glucose, particularly in muscle and adipose tissues, promotes energy storage via glycogenesis, opposes catabolism of energy stores, increases DNA replication and protein synthesis by stimulating amino acid uptake by liver, muscle and adipose tissue, and modifies the activity of numerous enzymes involved in glycogen synthesis and glycolysis. Insulin also promotes growth and is required for the actions of growth hormone (e.g. protein synthesis, cell division, DNA synthesis). Insulin lispro is a rapid-acting insulin analogue used to mimic postprandial insulin spikes in diabetic individuals. The onset of action of insulin lispro is 10-15 minutes. Its activity peaks 60 minutes following subcutaneous injection and its duration of action is 4-5 hours. Compared to regular human insulin, insulin lispro has a more rapid onset of action and a shorter duration of action. Insulin lispro is also shown to be equipotent to human insulin on a molar basis.
Mechanism of actionInsulin lispro binds to the insulin receptor (IR), a heterotetrameric protein consisting of two extracellular alpha units and two transmembrane beta units. The binding of insulin to the alpha subunit of IR stimulates the tyrosine kinase activity intrinsic to the beta subunit of the receptor. The bound receptor autophosphorylates and phosphorylates numerous intracellular substrates such as insulin receptor substrates (IRS) proteins, Cbl, APS, Shc and Gab 1. Activation of these proteins leads to the activation of downstream signaling molecules including PI3 kinase and Akt. Akt regulates the activity of glucose transporter 4 (GLUT4) and protein kinase C (PKC), both of which play critical roles in metabolism and catabolism. In humans, insulin is stored in the form of hexamers; however, only insulin monomers are able to interact with IR. Reversal of the proline and lysine residues at positions B28 and B29 of native insulin eliminates hydrophobic interactions and weakens some of the hydrogen bonds that contribute to the stability of the insulin dimers that comprise insulin hexamers. Hexamers of insulin lispro are produced in the presence of zinc and m-cresol. These weakly associated hexamers quickly dissociate upon subcutaneous injection and are absorbed as monomers through vascular endothelial cells. These properties give insulin lispro its fast-acting properties.
Related Articles
AbsorptionRapidly absorbed following subcutaneous administration. It is also absorbed more quickly than regular human insulin. Peak serum levels occur 30-90 minutes after injection in healthy subjects. Absorption also differs depending on the site of injection. After insulin lispro was administered in the abdomen, serum drug levels were higher and the duration of action was slightly shorter than after deltoid or thigh administration. Bioavailability, 0.1 - 0.2 unit/kg = 55% - 77%.
Volume of distribution

When administered intravenously as bolus injections of 0.1 and 0.2 U/kg dose in two separate groups of healthy subjects, the mean volume of distribution of insulin lispro appeared to decrease with increase in dose (1.55 and 0.72 L/kg, respectively).

Protein bindingNot Available
Metabolism

Insulin is predominantly cleared by metabolic degradation via a receptor-mediated process.

Route of eliminationNot Available
Half lifeSubQ administration = 1 hour
Clearance

Clearance is dose dependent. When a dose of 0.1 unit/kg and 0.2 unit/kg were administered intravenously, the mean clearance was 21.0 mL/min/kg and 9.6 mL/min/kg respectively.

ToxicityInappropriately high dosages relative to food intake and/or energy expenditure may result in severe and sometimes prolonged and life-threatening hypoglycemia. Neurogenic (autonomic) signs and symptoms of hypoglycemia include trembling, palpitations, sweating, anxiety, hunger, nausea and tingling. Neuroglycopenic signs and symptoms of hypoglycemia include difficulty concentrating, lethargy/weakness, confusion, drowsiness, vision changes, difficulty speaking, headache, and dizziness. Mild hypoglycemia is characterized by the presence of autonomic symptoms. Moderate hypoglycemia is characterized by the presence of autonomic and neuroglycopenic symptoms. Individuals may become unconscious in severe cases of hypoglycemia. Rare cases of lipoatrophy or lipohypertrophy reactions have been observed.
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
Manufacturers
  • Eli lilly and co
Packagers
Dosage forms
FormRouteStrength
Solution for injectionSubcutaneous or intravenous use100 U/ml
Solutionintramuscular; intravenous; subcutaneous100 unit
Solutionsubcutaneous200 unit
Solution for injectionSubcutaneous use200 U/ml
Suspension for injectionSubcutaneous use100 U/ml
Injection, suspensionsubcutaneous100 [iU]/mL
Liquidintramuscular; intravenous; subcutaneous100 unit
Prices
Unit descriptionCostUnit
HumaLOG KwikPen 100 unit/ml Solution (1box = 5 Pens = 15ml)240.18USD box
HumaLOG Mix 50/50 KwikPen 50-50% Suspension Five 3ml Pens Per Box = 15ml240.18USD box
HumaLOG Mix 75/25 KwikPen 75-25% Suspension Five 3ml Pen Per Box = 15ml240.18USD box
HumaLOG Mix 75/25 Pen 75-25% Suspension 15ml Box240.18USD box
HumaLOG Pen (five 3ml Pens Per Box) 15ml Box240.18USD box
HumaLOG 100 unit/ml Solution 1 Box = Five 3ml Cartridges = 15ml231.0USD box
HumaLOG 100 unit/ml Solution 10ml Vial124.36USD vial
Humalog 100 unit/ml kwikpen15.4USD ml
Humalog 100 unit/ml pen15.4USD ml
Humalog mix 50-50 kwikpen15.4USD ml
Humalog mix 50-50 pen15.4USD ml
Humalog mix 50/50 kwikpen11.83USD ml
Humalog 100 unit/ml Cartridge9.37USD cartridge
Humalog 100 unit/ml2.95USD cartridge
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2151560 No2000-05-092015-06-12Canada
CA2151564 No2003-02-112015-06-12Canada
US5474978 No1994-06-162014-06-16Us
US5514646 No1993-05-072013-05-07Us
US6034054 No1998-06-112018-06-11Us
US6551992 No1998-06-112018-06-11Us
US7291132 No2004-08-092024-08-09Us
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point81 °CKhachidze, D.G. et al., J. Biol. Phys. Chem. 1:64-67 (2001)
hydrophobicity0.218Not Available
isoelectric point5.39Not Available
References
Synthesis ReferenceNot Available
General References
  1. Miles HL, Acerini CL: Insulin analog preparations and their use in children and adolescents with type 1 diabetes mellitus. Paediatr Drugs. 2008;10(3):163-76. [PubMed:18454569 ]
  2. Zib I, Raskin P: Novel insulin analogues and its mitogenic potential. Diabetes Obes Metab. 2006 Nov;8(6):611-20. [PubMed:17026485 ]
External Links
ATC CodesA10AC04A10AB04A10AD04
AHFS Codes
  • 68:20.08
PDB Entries
FDA labelDownload (1.13 MB)
MSDSNot Available
Interactions
Drug Interactions
Drug
7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE may increase the hypoglycemic activities of Insulin Lispro.
AcarboseAcarbose may increase the hypoglycemic activities of Insulin Lispro.
AcetohexamideAcetohexamide may increase the hypoglycemic activities of Insulin Lispro.
Acetylsalicylic acidAcetylsalicylic acid may increase the hypoglycemic activities of Insulin Lispro.
AicarAicar may increase the hypoglycemic activities of Insulin Lispro.
AlogliptinAlogliptin may increase the hypoglycemic activities of Insulin Lispro.
Aminosalicylic AcidAminosalicylic Acid may increase the hypoglycemic activities of Insulin Lispro.
AmoxapineAmoxapine may increase the hypoglycemic activities of Insulin Lispro.
AripiprazoleThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Aripiprazole.
Arsenic trioxideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Arsenic trioxide.
ArticaineThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Articaine.
AsenapineThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Asenapine.
AtazanavirThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Atazanavir.
BendroflumethiazideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Bendroflumethiazide.
BenmoxinBenmoxin may increase the hypoglycemic activities of Insulin Lispro.
BetamethasoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Betamethasone.
BrexpiprazoleThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Brexpiprazole.
BuforminBuformin may increase the hypoglycemic activities of Insulin Lispro.
BumetanideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Bumetanide.
BuserelinThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Buserelin.
CanagliflozinCanagliflozin may increase the hypoglycemic activities of Insulin Lispro.
CaroxazoneCaroxazone may increase the hypoglycemic activities of Insulin Lispro.
CastanospermineCastanospermine may increase the hypoglycemic activities of Insulin Lispro.
CeritinibThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Ceritinib.
ChlorothiazideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Chlorothiazide.
ChlorpropamideInsulin Lispro may increase the hypoglycemic activities of Chlorpropamide.
ChlorthalidoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Chlorthalidone.
CiglitazoneCiglitazone may increase the hypoglycemic activities of Insulin Lispro.
CitalopramCitalopram may increase the hypoglycemic activities of Insulin Lispro.
ClomipramineClomipramine may increase the hypoglycemic activities of Insulin Lispro.
ClozapineThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Clozapine.
CorticotropinThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Corticotropin.
Cortisone acetateThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Cortisone acetate.
Cyproterone acetateThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Cyproterone acetate.
DabrafenibThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Dabrafenib.
DanazolThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Danazol.
DapoxetineDapoxetine may increase the hypoglycemic activities of Insulin Lispro.
DarunavirThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Darunavir.
DesogestrelThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Desogestrel.
DexamethasoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Dexamethasone.
DiazoxideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Diazoxide.
DienogestThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Dienogest.
DiflunisalDiflunisal may increase the hypoglycemic activities of Insulin Lispro.
DihydrotestosteroneDihydrotestosterone may increase the hypoglycemic activities of Insulin Lispro.
DisopyramideInsulin Lispro may increase the hypoglycemic activities of Disopyramide.
DrospirenoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Drospirenone.
DulaglutideDulaglutide may increase the hypoglycemic activities of Insulin Lispro.
EmpagliflozinEmpagliflozin may increase the hypoglycemic activities of Insulin Lispro.
EpinephrineThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Epinephrine.
EscitalopramEscitalopram may increase the hypoglycemic activities of Insulin Lispro.
EstradiolThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Estradiol.
Estrone sulfateThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Estrone sulfate.
Etacrynic acidThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Etacrynic acid.
Ethinyl EstradiolThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Ethinyl Estradiol.
Ethynodiol diacetateThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Ethynodiol diacetate.
EtonogestrelThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Etonogestrel.
EtoperidoneEtoperidone may increase the hypoglycemic activities of Insulin Lispro.
EverolimusThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Everolimus.
ExenatideExenatide may increase the hypoglycemic activities of Insulin Lispro.
FenfluramineFenfluramine may increase the hypoglycemic activities of Insulin Lispro.
FludrocortisoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Fludrocortisone.
FluoxetineFluoxetine may increase the hypoglycemic activities of Insulin Lispro.
FluoxymesteroneFluoxymesterone may increase the hypoglycemic activities of Insulin Lispro.
FluvoxamineFluvoxamine may increase the hypoglycemic activities of Insulin Lispro.
FosamprenavirThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Fosamprenavir.
FurazolidoneFurazolidone may increase the hypoglycemic activities of Insulin Lispro.
FurosemideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Furosemide.
GlibornurideGlibornuride may increase the hypoglycemic activities of Insulin Lispro.
GliclazideInsulin Lispro may increase the hypoglycemic activities of Gliclazide.
GlimepirideInsulin Lispro may increase the hypoglycemic activities of Glimepiride.
GlipizideInsulin Lispro may increase the hypoglycemic activities of Glipizide.
GliquidoneGliquidone may increase the hypoglycemic activities of Insulin Lispro.
GlyburideInsulin Lispro may increase the hypoglycemic activities of Glyburide.
GoserelinThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Goserelin.
HistrelinThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Histrelin.
HydracarbazineHydracarbazine may increase the hypoglycemic activities of Insulin Lispro.
HydrochlorothiazideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Hydrochlorothiazide.
HydrocortisoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Hydrocortisone.
HydroflumethiazideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Hydroflumethiazide.
Hydroxyprogesterone caproateThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Hydroxyprogesterone caproate.
IloperidoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Iloperidone.
IndalpineIndalpine may increase the hypoglycemic activities of Insulin Lispro.
IndapamideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Indapamide.
IndinavirThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Indinavir.
Insulin AspartInsulin Lispro may increase the hypoglycemic activities of Insulin Aspart.
Insulin DetemirInsulin Lispro may increase the hypoglycemic activities of Insulin Detemir.
Insulin GlargineInsulin Lispro may increase the hypoglycemic activities of Insulin Glargine.
Insulin GlulisineInsulin Lispro may increase the hypoglycemic activities of Insulin Glulisine.
Insulin HumanInsulin Lispro may increase the hypoglycemic activities of Insulin Human.
Insulin PorkInsulin Pork may increase the hypoglycemic activities of Insulin Lispro.
IproclozideIproclozide may increase the hypoglycemic activities of Insulin Lispro.
IproniazidIproniazid may increase the hypoglycemic activities of Insulin Lispro.
IsocarboxazidIsocarboxazid may increase the hypoglycemic activities of Insulin Lispro.
LanreotideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Lanreotide.
LanreotideInsulin Lispro may increase the hypoglycemic activities of Lanreotide.
LeuprolideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Leuprolide.
LevomilnacipranLevomilnacipran may increase the hypoglycemic activities of Insulin Lispro.
LevonorgestrelThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Levonorgestrel.
LinagliptinLinagliptin may increase the hypoglycemic activities of Insulin Lispro.
Lipoic AcidLipoic Acid may increase the hypoglycemic activities of Insulin Lispro.
LiraglutideLiraglutide may increase the hypoglycemic activities of Insulin Lispro.
LopinavirThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Lopinavir.
Lu AA21004Lu AA21004 may increase the hypoglycemic activities of Insulin Lispro.
LurasidoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Lurasidone.
MebanazineMebanazine may increase the hypoglycemic activities of Insulin Lispro.
MecaserminInsulin Lispro may increase the hypoglycemic activities of Mecasermin.
Medroxyprogesterone acetateThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Medroxyprogesterone acetate.
Megestrol acetateThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Megestrol acetate.
MesalazineMesalazine may increase the hypoglycemic activities of Insulin Lispro.
MestranolThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Mestranol.
MetforminMetformin may increase the hypoglycemic activities of Insulin Lispro.
MethotrimeprazineThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Methotrimeprazine.
MethyclothiazideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Methyclothiazide.
Methylene blueMethylene blue may increase the hypoglycemic activities of Insulin Lispro.
MethylprednisoloneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Methylprednisolone.
MethyltestosteroneMethyltestosterone may increase the hypoglycemic activities of Insulin Lispro.
MetolazoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Metolazone.
MifepristoneInsulin Lispro may increase the hypoglycemic activities of Mifepristone.
MiglitolMiglitol may increase the hypoglycemic activities of Insulin Lispro.
MiglustatMiglustat may increase the hypoglycemic activities of Insulin Lispro.
MilnacipranMilnacipran may increase the hypoglycemic activities of Insulin Lispro.
MinaprineMinaprine may increase the hypoglycemic activities of Insulin Lispro.
MitiglinideMitiglinide may increase the hypoglycemic activities of Insulin Lispro.
MoclobemideMoclobemide may increase the hypoglycemic activities of Insulin Lispro.
NateglinideInsulin Lispro may increase the hypoglycemic activities of Nateglinide.
NelfinavirThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Nelfinavir.
NiacinThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Niacin.
NialamideNialamide may increase the hypoglycemic activities of Insulin Lispro.
NilotinibThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Nilotinib.
NorethisteroneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Norethisterone.
NorgestimateThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Norgestimate.
OctamoxinOctamoxin may increase the hypoglycemic activities of Insulin Lispro.
OctreotideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Octreotide.
OctreotideInsulin Lispro may increase the hypoglycemic activities of Octreotide.
OlanzapineOlanzapine may increase the hypoglycemic activities of Insulin Lispro.
OxandroloneOxandrolone may increase the hypoglycemic activities of Insulin Lispro.
OxymetholoneOxymetholone may increase the hypoglycemic activities of Insulin Lispro.
PaliperidoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Paliperidone.
PargylinePargyline may increase the hypoglycemic activities of Insulin Lispro.
ParoxetineParoxetine may increase the hypoglycemic activities of Insulin Lispro.
PasireotideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Pasireotide.
PasireotideInsulin Lispro may increase the hypoglycemic activities of Pasireotide.
PegvisomantPegvisomant may increase the hypoglycemic activities of Insulin Lispro.
PentamidineThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Pentamidine.
PentamidineInsulin Lispro may increase the hypoglycemic activities of Pentamidine.
PhenelzinePhenelzine may increase the hypoglycemic activities of Insulin Lispro.
PhenforminPhenformin may increase the hypoglycemic activities of Insulin Lispro.
PheniprazinePheniprazine may increase the hypoglycemic activities of Insulin Lispro.
PhenoxypropazinePhenoxypropazine may increase the hypoglycemic activities of Insulin Lispro.
PioglitazonePioglitazone may increase the hypoglycemic activities of Insulin Lispro.
PiperazineThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Piperazine.
PipotiazineThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Pipotiazine.
PirlindolePirlindole may increase the hypoglycemic activities of Insulin Lispro.
PivhydrazinePivhydrazine may increase the hypoglycemic activities of Insulin Lispro.
PolythiazideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Polythiazide.
PramlintidePramlintide may increase the hypoglycemic activities of Insulin Lispro.
PrednisoloneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Prednisolone.
PrednisoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Prednisone.
ProgesteroneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Progesterone.
QuetiapineThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Quetiapine.
QuinethazoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Quinethazone.
QuinineInsulin Lispro may increase the hypoglycemic activities of Quinine.
RasagilineRasagiline may increase the hypoglycemic activities of Insulin Lispro.
RepaglinideInsulin Lispro may increase the hypoglycemic activities of Repaglinide.
RisperidoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Risperidone.
RitonavirThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Ritonavir.
RosiglitazoneRosiglitazone may increase the hypoglycemic activities of Insulin Lispro.
SafrazineSafrazine may increase the hypoglycemic activities of Insulin Lispro.
Salicylic acidSalicylic acid may increase the hypoglycemic activities of Insulin Lispro.
SaquinavirThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Saquinavir.
SaxagliptinSaxagliptin may increase the hypoglycemic activities of Insulin Lispro.
SelegilineSelegiline may increase the hypoglycemic activities of Insulin Lispro.
SertralineSertraline may increase the hypoglycemic activities of Insulin Lispro.
SirolimusThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Sirolimus.
SitagliptinSitagliptin may increase the hypoglycemic activities of Insulin Lispro.
StanozololStanozolol may increase the hypoglycemic activities of Insulin Lispro.
SulfadiazineInsulin Lispro may increase the hypoglycemic activities of Sulfadiazine.
SulfamethoxazoleInsulin Lispro may increase the hypoglycemic activities of Sulfamethoxazole.
SulfisoxazoleInsulin Lispro may increase the hypoglycemic activities of Sulfisoxazole.
SulodexideSulodexide may increase the hypoglycemic activities of Insulin Lispro.
SunitinibInsulin Lispro may increase the hypoglycemic activities of Sunitinib.
TacrolimusThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Tacrolimus.
TemsirolimusThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Temsirolimus.
TestosteroneTestosterone may increase the hypoglycemic activities of Insulin Lispro.
TipranavirThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Tipranavir.
TolazamideInsulin Lispro may increase the hypoglycemic activities of Tolazamide.
TolbutamideInsulin Lispro may increase the hypoglycemic activities of Tolbutamide.
ToloxatoneToloxatone may increase the hypoglycemic activities of Insulin Lispro.
TorasemideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Torasemide.
Trans-2-PhenylcyclopropylamineTrans-2-Phenylcyclopropylamine may increase the hypoglycemic activities of Insulin Lispro.
TranylcypromineTranylcypromine may increase the hypoglycemic activities of Insulin Lispro.
TrazodoneTrazodone may increase the hypoglycemic activities of Insulin Lispro.
TriamcinoloneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Triamcinolone.
TrichlormethiazideThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Trichlormethiazide.
TriptorelinThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Triptorelin.
TroglitazoneTroglitazone may increase the hypoglycemic activities of Insulin Lispro.
VilazodoneVilazodone may increase the hypoglycemic activities of Insulin Lispro.
VildagliptinVildagliptin may increase the hypoglycemic activities of Insulin Lispro.
VogliboseVoglibose may increase the hypoglycemic activities of Insulin Lispro.
VorinostatThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Vorinostat.
VortioxetineVortioxetine may increase the hypoglycemic activities of Insulin Lispro.
ZimelidineZimelidine may increase the hypoglycemic activities of Insulin Lispro.
ZiprasidoneThe therapeutic efficacy of Insulin Lispro can be decreased when used in combination with Ziprasidone.
Food Interactions
  • Inject subcutaneuosly 15 minutes before meal

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Receptor signaling protein tyrosine kinase activity
Specific Function:
Receptor tyrosine kinase which mediates the pleiotropic actions of insulin. Binding of insulin leads to phosphorylation of several intracellular substrates, including, insulin receptor substrates (IRS1, 2, 3, 4), SHC, GAB1, CBL and other signaling intermediates. Each of these phosphorylated proteins serve as docking proteins for other signaling proteins that contain Src-homology-2 domains (SH2 ...
Gene Name:
INSR
Uniprot ID:
P06213
Molecular Weight:
156331.465 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
  2. Jehle PM, Fussgaenger RD, Kunze U, Dolderer M, Warchol W, Koop I: The human insulin analog insulin lispro improves insulin binding on circulating monocytes of intensively treated insulin-dependent diabetes mellitus patients. J Clin Endocrinol Metab. 1996 Jun;81(6):2319-27. [PubMed:8964871 ]
  3. Jehle PM, Fussganger RD, Seibold A, Luttke B, Bohm BO: Pharmacodynamics of insulin Lispro in 2 patients with type II diabetes mellitus. Int J Clin Pharmacol Ther. 1996 Nov;34(11):498-503. [PubMed:8937933 ]
  4. Sciacca L, Cassarino MF, Genua M, Pandini G, Le Moli R, Squatrito S, Vigneri R: Insulin analogues differently activate insulin receptor isoforms and post-receptor signalling. Diabetologia. 2010 Aug;53(8):1743-53. doi: 10.1007/s00125-010-1760-6. Epub 2010 Apr 28. [PubMed:20424816 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Protein tyrosine kinase activity
Specific Function:
Receptor tyrosine kinase which mediates actions of insulin-like growth factor 1 (IGF1). Binds IGF1 with high affinity and IGF2 and insulin (INS) with a lower affinity. The activated IGF1R is involved in cell growth and survival control. IGF1R is crucial for tumor transformation and survival of malignant cell. Ligand binding activates the receptor kinase, leading to receptor autophosphorylation,...
Gene Name:
IGF1R
Uniprot ID:
P08069
Molecular Weight:
154791.73 Da
References
  1. Smith TJ: Insulin-like growth factor-I regulation of immune function: a potential therapeutic target in autoimmune diseases? Pharmacol Rev. 2010 Jun;62(2):199-236. doi: 10.1124/pr.109.002469. Epub 2010 Apr 14. [PubMed:20392809 ]

Enzymes

Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
inducer
General Function:
Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
Specific Function:
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Most active in catalyzing 2-hydroxylation. Caffeine is metabolized primarily by cytochrome CYP1A2 in the liver through an initial N...
Gene Name:
CYP1A2
Uniprot ID:
P05177
Molecular Weight:
58293.76 Da
References
  1. Drug Interactions: Cytochrome P450 Drug Interaction Table [Link]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on September 29, 2016 02:28