You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameRasburicase
Accession NumberDB00049  (BTD00090, BIOD00090)
TypeBiotech
GroupsApproved, Investigational
Description

Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus.

Protein structureDb00049
Related Articles
Protein chemical formulaC1521H2381N417O461S7
Protein average weight34109.5 Da
Sequences
>DB00049 sequence
SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKADNSVIVATDSI
KNTIYITAKQNPVTPPELFGSILGTHFIEKYNHIHAAHVNIVCHRWTRMDIDGKPHPHSF
IRDSEEKRNVQVDVVEGKGIDIKSSLSGLTVLKSTNSQFWGFLRDEYTTLKETWDRILST
DVDATWQWKNFSGLQEVRSHVPKFDATWATAREVTLKTFAEDNSASVQATMYKMAEQILA
RQQLIETVEYSLPNKHYFEIDLSWHKGLQNTGKNAEVFAPQSDPNGLIKCTVGRSSLKSK
L
Download FASTA Format
Synonyms
Urate oxidase
Uricase
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
ElitekkitSanofi Aventis U.S. Llc2002-07-12Not applicableUs
ElitekkitSanofi Aventis U.S. Llc2006-06-01Not applicableUs
Fasturtecpowder for solution7.5 mgintravenousSanofi Aventis Canada IncNot applicableNot applicableCanada
Fasturtecpowder for solution1.5 mgintravenousSanofi Aventis Canada Inc2004-09-21Not applicableCanada
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNII08GY9K1EUO
CAS number134774-45-1
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationFor treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy)
PharmacodynamicsDrugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis.
Mechanism of actionRasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin).
Related Articles
AbsorptionNot Available
Volume of distribution
  • 110 to 127 mL/kg [pediatric patients]
  • 75.8 to 138 mL/kg [adult patients]
Protein bindingNot Available
MetabolismNot Available
Route of eliminationNot Available
Half life18 hours
ClearanceNot Available
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Kit
Powder for solutionintravenous1.5 mg
Powder for solutionintravenous7.5 mg
Prices
Unit descriptionCostUnit
Elitek 7.5 mg vial3136.18USD vial
Elitek 1.5 mg vial627.23USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2148537 No2002-07-162015-05-03Canada
CA2175971 No2003-12-302016-05-07Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.465Not Available
isoelectric point7.16Not Available
References
Synthesis Reference

Roy Eugene Snoke, Hugh Arthur Risley, Charles Thomas Goodhue, “Production of uricase from micrococcus luteus.” U.S. Patent US4062731, issued May, 1974.

US4062731
General References
  1. Collings I, Watier Y, Giffard M, Dagogo S, Kahn R, Bonnete F, Wright JP, Fitch AN, Margiolaki I: Polymorphism of microcrystalline urate oxidase from Aspergillus flavus. Acta Crystallogr D Biol Crystallogr. 2010 May;66(Pt 5):539-48. doi: 10.1107/S0907444910005354. Epub 2010 Apr 21. [PubMed:20445229 ]
  2. Giraldez M, Puto K: A single, fixed dose of rasburicase (6 mg maximum) for treatment of tumor lysis syndrome in adults. Eur J Haematol. 2010 Aug;85(2):177-9. doi: 10.1111/j.1600-0609.2010.01457.x. Epub 2010 Apr 12. [PubMed:20394650 ]
External Links
ATC CodesM04AX01V03AF07
AHFS Codes
  • 44:00.00
PDB Entries
FDA labelDownload (49.1 KB)
MSDSNot Available
Interactions
Drug InteractionsNo interactions found.
Food InteractionsNot Available

Targets

Kind
Small molecule
Organism
Human
Pharmacological action
yes
Actions
metabolizer
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
  3. Cete S, Yasar A, Arslan F: An amperometric biosensor for uric acid determination prepared from uricase immobilized in polypyrrole film. Artif Cells Blood Substit Immobil Biotechnol. 2006;34(3):367-80. [PubMed:16809136 ]
  4. Gabison L, Chiadmi M, Colloc'h N, Castro B, El Hajji M, Prange T: Recapture of [S]-allantoin, the product of the two-step degradation of uric acid, by urate oxidase. FEBS Lett. 2006 Apr 3;580(8):2087-91. Epub 2006 Mar 10. [PubMed:16545381 ]
  5. Zhao Y, Zhao L, Yang G, Tao J, Bu Y, Liao F: Characterization of a uricase from Bacillus fastidious A.T.C.C. 26904 and its application to serum uric acid assay by a patented kinetic uricase method. Biotechnol Appl Biochem. 2006 Sep;45(Pt 2):75-80. [PubMed:16689679 ]
  6. Giraldez M, Puto K: A single, fixed dose of rasburicase (6 mg maximum) for treatment of tumor lysis syndrome in adults. Eur J Haematol. 2010 Aug;85(2):177-9. doi: 10.1111/j.1600-0609.2010.01457.x. Epub 2010 Apr 12. [PubMed:20394650 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23