| Identification |
| Name |
Rasburicase |
| Accession Number |
DB00049
(BIOD00090, BTD00090)
|
| Type |
biotech |
| Groups |
approved |
| Description |
Rasburicase is a recombinant urate-oxidase enzyme produced by a genetically modified Saccharomyces cerevisiae strain. The cDNA coding for rasburicase was cloned from a strain of Aspergillus flavus. |
| Protein structure |
Display:
3D Structure
|
| Protein chemical formula |
C1521H2381N417O461S7 |
| Protein average weight |
34109.5000 |
| Sequences |
>DB00049 sequence
SAVKAARYGKDNVRVYKVHKDEKTGVQTVYEMTVCVLLEGEIETSYTKADNSVIVATDSI
KNTIYITAKQNPVTPPELFGSILGTHFIEKYNHIHAAHVNIVCHRWTRMDIDGKPHPHSF
IRDSEEKRNVQVDVVEGKGIDIKSSLSGLTVLKSTNSQFWGFLRDEYTTLKETWDRILST
DVDATWQWKNFSGLQEVRSHVPKFDATWATAREVTLKTFAEDNSASVQATMYKMAEQILA
RQQLIETVEYSLPNKHYFEIDLSWHKGLQNTGKNAEVFAPQSDPNGLIKCTVGRSSLKSK
L
FASTA
|
| Synonyms |
|
| Salts |
Not Available |
| Brand names |
| Name |
Company |
| Elitek |
|
| Elitek (Sanofi-Synthelabo Inc) |
|
| Fasturtec |
|
|
| Brand mixtures |
Not Available |
| Categories |
|
| CAS number |
134774-45-1 |
| Taxonomy |
| Kingdom |
Not Available |
| Classes |
Not Available |
| Substructures |
Not Available |
| Pharmacology |
| Indication |
For treatment of hyperuricemia, reduces elevated plasma uric acid levels (from chemotherapy) |
| Pharmacodynamics |
Drugs used to treat lympohoid leukemia, non-Hodgkin's lymphoma and acute myelogenous leukemia often lead to the accumulation of toxic plasma levels of purine metabolites (i.e. uric acid). The injection of rasburicase reduces levels of uric acid and mitigates the toxic effects of chemotherapy induced tumor lysis. |
| Mechanism of action |
Rasburicase catalyzes enzymatic oxidation of uric acid into an inactive and soluble metabolite (allantoin). |
| Absorption |
Not Available |
| Volume of distribution |
- 110 to 127 mL/kg [pediatric patients]
- 75.8 to 138 mL/kg [adult patients]
|
| Protein binding |
Not Available |
| Metabolism |
Not Available
|
| Route of elimination |
Not Available |
| Half life |
18 hours |
| Clearance |
Not Available |
| Toxicity |
Not Available |
| Affected organisms |
|
| Pathways |
Not Available |
| Pharmacoeconomics |
| Manufacturers |
Not Available |
| Packagers |
|
| Dosage forms |
| Form |
Route |
Strength |
| Powder, for solution |
Intravenous |
|
|
| Prices |
| Unit description |
Cost |
Unit |
| Elitek 7.5 mg vial |
3136.18 USD |
vial |
| Elitek 1.5 mg vial |
627.23 USD |
vial |
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational
purposes only.
|
| Patents |
| Country |
Patent Number |
Approved |
Expires (estimated) |
| Canada |
2175971 |
2003-12-30 |
2016-05-07 |
| Canada |
2148537 |
2002-07-16 |
2015-05-03 |
|
| Properties |
| State |
liquid |
| Experimental Properties |
| Property |
Value |
Source |
| hydrophobicity |
-0.465 |
Not Available |
| isoelectric point |
7.16 |
Not Available |
|
| References |
| Synthesis Reference |
Not Available
|
| General Reference |
- Giraldez M: A single, fixed dose of Rasburicase (6 mg maximum) for Treatment of Tumor Lysis Syndrome in Adults. Eur J Haematol. 2010 Apr 12. Pubmed 20394650
- Collings I, Watier Y, Giffard M, Dagogo S, Kahn R, Bonnete F, Wright JP, Fitch AN, Margiolaki I: Polymorphism of microcrystalline urate oxidase from Aspergillus flavus. Acta Crystallogr D Biol Crystallogr. 2010 May;66(Pt 5):539-48. Epub 2010 Apr 21. Pubmed
|
| External Links |
|
| ATC Codes |
|
| AHFS Codes |
|
| PDB Entries |
|
| FDA label |
show (49.1 KB)
|
| MSDS |
Not Available
|
| Interactions |
| Drug Interactions |
Searched, but no interactions found. |
| Food Interactions |
Not Available |