| Identification | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Name | Daclizumab | ||||||||||||||||
| Accession Number | DB00111 (BIOD00007, BTD00007) | ||||||||||||||||
| Type | biotech | ||||||||||||||||
| Groups | approved | ||||||||||||||||
| Description | Humanized IgG1 Mab that binds to the human interleukin-2 receptor (anti-Tac or anti-CD25). Daclizumab is a composite of human (90%) and murine (10%) antibody sequences. The human sequences were derived from the constant domains of human IgG1 and the variable framework regions of the Eu myeloma antibody. The murine sequences were derived from the complementarity-determining regions of a murine anti-Tac antibody. |
||||||||||||||||
| Protein structure |
Display: 3D Structure |
||||||||||||||||
| Protein chemical formula | C6332H9808N1678O1989S42 | ||||||||||||||||
| Protein average weight | 142612.1000 | ||||||||||||||||
| Sequences |
>Humanized Anti-CD25 Heavy Chain 1 QVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYRMHWVRQAPGQGLEWIGYINPSTGYTEY NQKFKDKATITADESTNTAYMELSSLRSEDTAVYYCARGGGVFDYWGQGTTLTVSSGPSV FPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV VTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPGK >Humanized Anti-CD25 Light Chain 1 DIQMTQSPSTLSASVGDRVTITCSASSSISYMHWYQQKPGKAPKLLIYTTSNLASGVPAR FSGSGSGTEFTLTISSLQPDDFATYYCHQRSTYPLTFGSGTKVEVKRTVAAPSVFIFPPS DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNR >Humanized Anti-CD25 Heavy Chain 2 QVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYRMHWVRQAPGQGLEWIGYINPSTGYTEY NQKFKDKATITADESTNTAYMELSSLRSEDTAVYYCARGGGVFDYWGQGTTLTVSSGPSV FPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV VTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLGGPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC SVMHEALHNHYTQKSLSLSPGK >Humanized Anti-CD25 Light Chain 2 DIQMTQSPSTLSASVGDRVTITCSASSSISYMHWYQQKPGKAPKLLIYTTSNLASGVPAR FSGSGSGTEFTLTISSLQPDDFATYYCHQRSTYPLTFGSGTKVEVKRTVAAPSVFIFPPS DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNR FASTA |
||||||||||||||||
| Synonyms |
|
||||||||||||||||
| Synonyms |
|
||||||||||||||||
| Salts | Not Available | ||||||||||||||||
| Brand names |
|
||||||||||||||||
| Brand mixtures | Not Available | ||||||||||||||||
| Categories |
|
||||||||||||||||
| CAS number | 152923-56-3 | ||||||||||||||||
| Taxonomy | |||||||||||||||||
| Kingdom | Not Available | ||||||||||||||||
| Classes | Not Available | ||||||||||||||||
| Substructures | Not Available | ||||||||||||||||
| Pharmacology | |||||||||||||||||
| Indication | Zenapax is a humanized monoclonal antibody used for prevention of renal transplant rejection | ||||||||||||||||
| Pharmacodynamics | Zenapax functions as an IL-2 receptor antagonist. Specifically it inhibits IL-2-mediated activation of lymphocytes, a critical pathway in the cellular immune response involved in allograft rejection. | ||||||||||||||||
| Mechanism of action | Zenepax binds with high-affinity to the Tac subunit of the high-affinity IL-2 receptor complex and inhibits IL-2 binding. The IL-2 receptor (Tac) subunit is expressed on activated but not resting lymphocytes. | ||||||||||||||||
| Absorption | Not Available | ||||||||||||||||
| Volume of distribution | Not Available | ||||||||||||||||
| Protein binding | Not Available | ||||||||||||||||
| Metabolism | Most likely removed by opsonization via the reticuloendothelial system when bound to lymphocytes. | ||||||||||||||||
| Route of elimination | Not Available | ||||||||||||||||
| Half life | 11-38 days | ||||||||||||||||
| Clearance | Not Available | ||||||||||||||||
| Toxicity | Not Available | ||||||||||||||||
| Affected organisms |
|
||||||||||||||||
| Pathways | Not Available | ||||||||||||||||
| Pharmacoeconomics | |||||||||||||||||
| Manufacturers | Not Available | ||||||||||||||||
| Packagers | |||||||||||||||||
| Dosage forms |
|
||||||||||||||||
| Prices | Not Available | ||||||||||||||||
| Patents | Not Available | ||||||||||||||||
| Properties | |||||||||||||||||
| State | liquid | ||||||||||||||||
| Melting point | 61 oC (FAB fragment), 71 oC (whole mAb) - Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000). | ||||||||||||||||
| Experimental Properties |
|
||||||||||||||||
| References | |||||||||||||||||
| Synthesis Reference | Not Available | ||||||||||||||||
| General Reference | Not Available | ||||||||||||||||
| External Links |
|
||||||||||||||||
| ATC Codes |
|
||||||||||||||||
| AHFS Codes |
|
||||||||||||||||
| PDB Entries | |||||||||||||||||
| FDA label | show (666 KB) | ||||||||||||||||
| MSDS | Not Available | ||||||||||||||||
| Interactions | |||||||||||||||||
| Drug Interactions |
|
||||||||||||||||
| Food Interactions | Not Available | ||||||||||||||||
| Targets |
|---|
|
1. Interleukin-2 receptor alpha chain Pharmacological action: yesActions: antibody Receptor for interleukin-2 Organism class: humanUniProt ID: P01589 ![]() Gene: IL2RA ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References:
2. Interleukin-2 receptor subunit beta Pharmacological action: yesActions: antibody Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2 Organism class: humanUniProt ID: P14784 ![]() Gene: IL2RB ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References:
3. Low affinity immunoglobulin gamma Fc region receptor III-B Pharmacological action: unknownReceptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils Organism class: humanUniProt ID: O75015 ![]() Gene: FCGR3B ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References:
4. Complement C1r subcomponent Pharmacological action: unknownC1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system Organism class: humanUniProt ID: P00736 ![]() Gene: C1R ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References: 5. Complement C1q subcomponent subunit A Pharmacological action: unknownC1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes Organism class: humanUniProt ID: P02745 ![]() Gene: C1QA ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References: 6. Complement C1q subcomponent subunit B Pharmacological action: unknownC1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes Organism class: humanUniProt ID: P02746 ![]() Gene: C1QB ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References: 7. Complement C1q subcomponent subunit C Pharmacological action: unknownC1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes Organism class: humanUniProt ID: P02747 ![]() Gene: C1QC ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References: 8. Low affinity immunoglobulin gamma Fc region receptor III-A Pharmacological action: unknownReceptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis Organism class: humanUniProt ID: P08637 ![]() Gene: FCGR3A ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References: 9. High affinity immunoglobulin gamma Fc receptor I Pharmacological action: unknownBinds to the Fc region of immunoglobulins gamma. High affinity receptor Organism class: humanUniProt ID: P12314 ![]() Gene: FCGR1A ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References:
10. Low affinity immunoglobulin gamma Fc region receptor II-a Pharmacological action: unknownBinds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens Organism class: humanUniProt ID: P12318 ![]() Gene: FCGR2A ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References: 11. Low affinity immunoglobulin gamma Fc region receptor II-b Pharmacological action: unknownReceptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B- cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells (TCR) or via another Fc receptor. Isoform IIB1 fails to mediate endocytosis or phagocytosis. Isoform IIB2 does not trigger phagocytosis Organism class: humanUniProt ID: P31994 ![]() Gene: FCGR2B ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References: 12. Low affinity immunoglobulin gamma Fc region receptor II-c Pharmacological action: unknownReceptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells Organism class: humanUniProt ID: P31995 ![]() Gene: FCGR2C ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References: |
| Comments |
|---|