| Version |
2.5 |
| Creation Date |
2005-06-13 13:24:05 |
| Update Date |
2009-04-16 16:47:54 |
| Primary Accession Number |
DB00682 |
| Secondary Accession Number |
|
| Name |
Warfarin |
| Drug Type |
|
| Description |
An anticoagulant that acts by inhibiting the synthesis of vitamin K-dependent coagulation factors. Warfarin is indicated for the prophylaxis and/or treatment of venous thrombosis and its extension, pulmonary embolism, and atrial fibrillation with embolization. It is also used as an adjunct in the prophylaxis of systemic embolism after myocardial infarction. Warfarin is also used as a rodenticide. [PubChem] |
| Synonyms |
- Warfarin sodium
|
| Brand Names |
- Athrombin
- Athrombin-K
- Athrombine-K
- Brumolin
- Co-Rax
- Coumadin
- Coumafen
- Coumafene
- Coumaphen
- Coumaphene
- Coumarins
- Coumefene
- D-Con
- Dethmor
- Dethnel
- Dicusat E
- Frass-Ratron
- Jantoven
- Kumader
- Kumadu
- Kumatox
- Kypfarin
- Latka 42
- Mar-Frin
- Marevan
- Maveran
- Panwarfin
- Place-Pax
- Prothromadin
- RAX
- Rosex
- Sofarin
- Solfarin
- Sorexa Plus
- Temus W
- Tintorane
- Tox-Hid
- Vampirinip II
- Vampirinip III
- Waran
- Warf 42
- Warfarat
- Warfarin Plus
- Warfarin Q
- Warfarine
- Warficide
- Warfilone
- Zoocoumarin
|
| Brand Mixtures |
Not Available |
| Chemical IUPAC Name |
2-hydroxy-3-(3-oxo-1-phenylbutyl)chromen-4-one |
| Chemical Formula |
C19H16O4 |
| Chemical Structure |
 |
| CAS Registry Number |
81-81-2 |
| InChI Identifier |
InChI=1/C19H16O4/c1-12(20)11-15(13-7-3-2-4-8-13)17-18(21)14-9-5-6-10-16(14)23-19(17)22/h2-10,15,22H,11H2,1H3 |
| InChI Key |
QTXVAVXCBMYBJW-UHFFFAOYAL |
| KEGG Drug |
Not Available |
| KEGG Compound |
C01541  |
| PubChem Compound |
6691  |
| PubChem Substance |
4702  |
| ChEBI ID |
Not Available |
| PharmGKB ID |
PA451906  |
| HET ID |
Not Available |
| GenBank ID |
Not Available |
| Drug ID Number [DIN] |
02244463  |
| RxList Link |
http://www.rxlist.com/cgi/generic/warfarin.htm  |
| PDRhealth Link |
Not Available |
| Wikipedia Link |
http://en.wikipedia.org/wiki/Warfarin  |
| FDA Label |
|
| Material Safety Data Sheet (MSDS) |
|
| Synthesis Reference |
Stahmann, et al., U.S. Pat. 2,427,578 (1947) |
| Average Molecular Weight |
308.3279 |
| Monoisotopic Molecular Weight |
308.1049 |
| State |
Solid |
| Melting Point |
161 oC |
| Experimental Water Solubility |
17 mg/L
Source: PhysProp
|
| Predicted Water Solubility |
4.77e-02 mg/mL
Calculated using ALOGPS
|
| Experimental LogP/Hydrophobicity |
3
Source: PhysProp
|
| Predicted LogP |
2.55
Calculated using ALOGPS
|
| Experimental LogS |
-3.89 [ADME Research, USCD] |
| Predicted LogS |
-3.81
Calculated using ALOGPS
|
| Experimental Caco2 Permeability |
-4.68 [ADME Research, USCD] |
| pKa/Isoelectric Point |
5.08 |
| Mass Spectrum |
Not Available
|
| MOL File |
Show | Download  |
| SDF File |
Show | Download  |
| PDB File |
Show | Download  |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
Not Available |
| Isomeric SMILES |
CC(=O)C[C@@H](C1=CC=CC=C1)C1=C(O)OC2=CC=CC=C2C1=O |
| Canonical SMILES |
CC(=O)CC(C1=CC=CC=C1)C1=C(O)OC2=CC=CC=C2C1=O |
| Drug Category |
- Anticoagulants
- Coumarin and Indandione Derivatives
- Rodenticides
|
| ATC Codes |
|
| AHFS Codes |
|
| Indication |
For the treatment of retinal vascular occlusion, pulmonary embolism, cardiomyopathy, atrial fibrillation and flutter, cerebral embolism, transient cerebral ischaemia, arterial embolism and thrombosis. |
| Pharmacology |
Warfarin, a coumarin anticoagulant, is a racemic mixture of two active isomers. It is used in the prevention and treatment of thromboembolic disease including venous thrombosis, thromboembolism, and pulmonary embolism as well as for the prevention of ischemic stroke in patients with atrial fibrillation (AF). |
| Mechanism of Action |
Warfarin inhibits vitamin K reductase, resulting in depletion of the reduced form of vitamin K (vitamin KH2). As vitamin K is a cofactor for the carboxylation of glutamate residues on the N-terminal regions of vitamin K-dependent proteins, this limits the gamma-carboxylation and subsequent activation of the vitamin K-dependent coagulant proteins. The synthesis of vitamin K-dependent coagulation factors II, VII, IX, and X and anticoagulant proteins C and S is inhibited. Depression of three of the four vitamin K-dependent coagulation factors (factors II, VII, and X) results in decresed prothrombin levels and a decrease in the amount of thrombin generated and bound to fibrin. This reduces the thrombogenicity of clots. |
| Absorption |
Not Available |
| Toxicity |
LD50=374 (orally in mice) |
| Protein Binding |
99.5% |
| Biotransformation |
Metabolized by hepatic microsomal enzymes. |
| Half Life |
1 week |
| Dosage Forms |
|
| Patient Information |
Not Available |
| Contraindications |
Show  |
| Interactions |
Show  |
| Drug Interactions |
Not Available
|
| Food Interactions |
- Avoid St.John's Wort.
- Avoid alcohol.
- Avoid drastic changes in dietary habit.
- Consult your doctor before taking large amounts of Vitamin K (Green leafy vegetables).
- Limit garlic, ginger, gingko, and horse chestnut.
|
| Pathways |
| Name |
SMPDB Link |
KEGG Link |
| Warfarin Pathway |
SMP00268  |
|
|
| General References |
- Hirsh J, Fuster V, Ansell J, Halperin JL: American Heart Association/American College of Cardiology Foundation guide to warfarin therapy. J Am Coll Cardiol. 2003 May 7;41(9):1633-52. [PubMed
]
- Rost S, Fregin A, Ivaskevicius V, Conzelmann E, Hortnagel K, Pelz HJ, Lappegard K, Seifried E, Scharrer I, Tuddenham EG, Muller CR, Strom TM, Oldenburg J: Mutations in VKORC1 cause warfarin resistance and multiple coagulation factor deficiency type 2. Nature. 2004 Feb 5;427(6974):537-41. [PubMed
]
- Li T, Chang CY, Jin DY, Lin PJ, Khvorova A, Stafford DW: Identification of the gene for vitamin K epoxide reductase. Nature. 2004 Feb 5;427(6974):541-4. [PubMed
]
- Ansell J, Hirsh J, Poller L, Bussey H, Jacobson A, Hylek E: The pharmacology and management of the vitamin K antagonists: the Seventh ACCP Conference on Antithrombotic and Thrombolytic Therapy. Chest. 2004 Sep;126(3 Suppl):204S-233S. [PubMed
]
- Whitlon DS, Sadowski JA, Suttie JW: Mechanism of coumarin action: significance of vitamin K epoxide reductase inhibition. Biochemistry. 1978 Apr 18;17(8):1371-7. [PubMed
]
- Drugs.com

- Wikipedia

- RxList

|
| Organisms Affected |
|
| Phase 1 Metabolizing Enzymes |
- Cytochrome P450 1A2 (CYP1A2)
- Cytochrome P450 2C8 (CYP2C8)
- Cytochrome P450 2C9 (CYP2C9)
|
| Targets |
- Prothrombin
- Vitamin K epoxide reductase complex subunit 1
- Vitamin K epoxide reductase complex subunit 1-like protein 1
|
|
Drug Target 1
[top]
|
| Target 1 ID |
54 |
| Target 1 Name |
Prothrombin |
| Target 1 Synonyms |
- Activated Factor II [IIa]
- Coagulation factor II
- EC 3.4.21.5
- Prothrombin precursor
- Thrombin
|
| Target 1 Gene Name |
F2 |
| Target 1 Protein Sequence |
>Prothrombin precursor
MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC
VEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHV
NITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQE
CSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASA
QAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETG
DGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYI
DGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN
DLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHP
VCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDST
RIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY
GFYTHVFRLKKWIQKVIDQFGE
|
| Target 1 Number of Residues |
632 |
| Target 1 Molecular Weight |
70037 |
| Target 1 Theoretical pI |
5.70 |
| Target 1 GO Classification |
|
Function
|
thrombin activity
binding
ion binding
cation binding
calcium ion binding
catalytic activity
hydrolase activity
peptidase activity
endopeptidase activity
serine-type endopeptidase activity |
|
Process
|
organismal physiological process
regulation of body fluids
hemostasis
blood coagulation
physiological process
metabolism
macromolecule metabolism
protein metabolism
cellular protein metabolism
proteolysis |
|
Component
|
| extracellular region |
|
| Target 1 General Function |
Involved in blood clotting cascade |
| Target 1 Specific Function |
Thrombin, which cleaves bonds after Arg and Lys, converts fibrinogen to fibrin and activates factors V, VII, VIII, XIII, and, in complex with thrombomodulin, protein C |
| Target 1 Pathways |
Not Available
|
| Target 1 Reactions |
- Selective cleavage of Arg!Gly bonds in fibrinogen to form fibrin and release fibrinopeptides A and B INHIBITOR Benzamidine; D-Phe-Pro-Arg-CH2Cl; Nalpha-(2-naphthyl-sulfonyl-glycyl)-D-p-amidinopheyl-alanylpiperadin e; Argatroban
|
| Target 1 Pfam Domain Function |
|
| Target 1 Signals |
|
| Target 1 Transmembrane Regions |
|
| Target 1 Essentiality |
Non-Essential |
| Target 1 GenBank ID Protein |
339641  |
| Target 1 UniProtKB/Swiss-Prot ID |
P00734  |
| Target 1 UniProtKB/Swiss-Prot Entry Name |
THRB_HUMAN  |
| Target 1 PDB ID |
1HAG  |
| Target 1 PDB File |
Show |
| Target 1 3D Structure |
|
| Target 1 Cellular Location |
- Secreted protein
- extracellular space
|
| Target 1 Gene Sequence |
>1869 bp
ATGGCGCACGTCCGAGGCTTGCAGCTGCCTGGCTGCCTGGCCCTGGCTGCCCTGTGTAGC
CTTGTGCACAGCCAGCATGTGTTCCTGGCTCCTCAGCAAGCACGGTCGCTGCTCCAGCGG
GTCCGGCGAGCCAACACCTTCTTGGAGGAGGTGCGCAAGGGCAACCTAGAGCGAGAGTGC
GTGGAGGAGACGTGCAGCTACGAGGAGGCCTTCGAGGCTCTGGAGTCCTCCACGGCTACG
GATGTGTTCTGGGCCAAGTACACAGCTTGTGAGACAGCGAGGACGCCTCGAGATAAGCTT
GCTGCATGTCTGGAAGGTAACTGTGCTGAGGGTCTGGGTACGAACTACCGAGGGCATGTG
AACATCACCCGGTCAGGCATTGAGTGCCAGCTATGGAGGAGTCGCTACCCACATAAGCCT
GAAATCAACTCCACTACCCATCCTGGGGCCGACCTACAGGAGAATTTCTGCCGCAACCCC
GACAGCAGCACCACGGGACCCTGGTGCTACACTACAGACCCCACCGTGAGGAGGCAGGAA
TGCAGCATCCCTGTCTGTGGCCAGGATCAAGTCACTGTAGCGATGACTCCACGCTCCGAA
GGCTCCAGTGTGAATCTGTCACCTCCATTGGAGCAGTGTGTCCCTGATCGGGGGCAGCAG
TACCAGGGGCGCCTGGCGGTGACCACACATGGGCTCCCCTGCCTGGCCTGGGCCAGCGCA
CAGGCCAAGGCCCTGAGCAAGCACCAGGACTTCAACTCAGCTGTGCAGCTGGTGGAGAAC
TTCTGCCGCAACCCAGACGGGGATGAGGAGGGCGTGTGGTGCTATGTGGCCGGGAAGCCT
GGCGACTTTGGGTACTGCGACCTCAACTATTGTGAGGAGGCCGTGGAGGAGGAGACAGGA
GATGGGCTGGATGAGGACTCAGACAGGGCCATCGAAGGGCGTACCGCCACCAGTGAGTAC
CAGACTTTCTTCAATCCGAGGACCTTTGGCTCGGGAGAGGCAGACTGTGGGCTGCGACCT
CTGTTCGAGAAGAAGTCGCTGGAGGACAAAACCGAAAGAGAGCTCCTGGAATCCTACATC
GACGGGCGCATTGTGGAGGGCTCGGATGCAGAGATCGGCATGTCACCTTGGCAGGTGATG
CTTTTCCGGAAGAGTCCCCAGGAGCTGCTGTGTGGGGCCAGCCTCATCAGTGACCGCTGG
GTCCTCACCGCCGCCCACTGCCTCCTGTACCCGCCCTGGGACAAGAACTTCACCGAGAAT
GACCTTCTGGTGCGCATTGGCAAGCACTCCCGCACAAGGTACGAGCGAAACATTGAAAAG
ATATCCATGTTGGAAAAGATCTACATCCACCCCAGGTACAACTGGCGGGAGAACCTGGAC
CGGGACATTGCCCTGATGAAGCTGAAGAAGCCTGTTGCCTTCAGTGACTACATTCACCCT
GTGTGTCTGCCCGACAGGGAGACGGCAGCCAGCTTGCTCCAGGCTGGATACAAGGGGCGG
GTGACAGGCTGGGGCAACCTGAAGGAGACGTGGACAGCCAACGTTGGTAAGGGGCAGCCC
AGTGTCCTGCAGGTGGTGAACCTGCCCATTGTGGAGCGGCCGGTCTGCAAGGACTCCACC
CGGATCCGCATCACTGACAACATGTTCTGTGCTGGTTACAAGCCTGATGAAGGGAAACGA
GGGGATGCCTGTGAAGGTGACAGTGGGGGACCCTTTGTCATGAAGAGCCCCTTTAACAAC
CGCTGGTATCAAATGGGCATCGTCTCATGGGGTGAAGGCTGTGACCGGGATGGGAAATAT
GGCTTCTACACACATGTGTTCCGCCTGAAGAAGTGGATACAGAAGGTCATTGATCAGTTT
GGAGAGTAG
|
| Target 1 GenBank Gene ID |
|
| Target 1 GeneCard ID |
F2  |
| Target 1 GenAtlas ID |
F2  |
| Target 1 HGNC ID |
HGNC:3535  |
| Target 1 Chromosome Location |
11 |
| Target 1 Locus |
11p11-q12 |
| Target 1 SNPs |
SNPJam Report  |
| Target 1 General References |
- Guinto ER, Caccia S, Rose T, Futterer K, Waksman G, Di Cera E: Unexpected crucial role of residue 225 in serine proteases. Proc Natl Acad Sci U S A. 1999 Mar 2;96(5):1852-7. [PubMed
]
- Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. [PubMed
]
- Iwahana H, Yoshimoto K, Shigekiyo T, Shirakami A, Saito S, Itakura M: Detection of a single base substitution of the gene for prothrombin Tokushima. The application of PCR-SSCP for the genetic and molecular analysis of dysprothrombinemia. Int J Hematol. 1992 Feb;55(1):93-100. [PubMed
]
- Miyata T, Aruga R, Umeyama H, Bezeaud A, Guillin MC, Iwanaga S: Prothrombin Salakta: substitution of glutamic acid-466 by alanine reduces the fibrinogen clotting activity and the esterase activity. Biochemistry. 1992 Aug 25;31(33):7457-62. [PubMed
]
- Morishita E, Saito M, Kumabashiri I, Asakura H, Matsuda T, Yamaguchi K: Prothrombin Himi: a compound heterozygote for two dysfunctional prothrombin molecules (Met-337-->Thr and Arg-388-->His). Blood. 1992 Nov 1;80(9):2275-80. [PubMed
]
- Rydel TJ, Ravichandran KG, Tulinsky A, Bode W, Huber R, Roitsch C, Fenton JW 2nd: The structure of a complex of recombinant hirudin and human alpha-thrombin. Science. 1990 Jul 20;249(4966):277-80. [PubMed
]
- Bode W, Mayr I, Baumann U, Huber R, Stone SR, Hofsteenge J: The refined 1.9 A crystal structure of human alpha-thrombin: interaction with D-Phe-Pro-Arg chloromethylketone and significance of the Tyr-Pro-Pro-Trp insertion segment. EMBO J. 1989 Nov;8(11):3467-75. [PubMed
]
- Walz DA, Hewett-Emmett D, Seegers WH: Amino acid sequence of human prothrombin fragments 1 and 2. Proc Natl Acad Sci U S A. 1977 May;74(5):1969-72. [PubMed
]
- Henriksen RA, Mann KG: Substitution of valine for glycine-558 in the congenital dysthrombin thrombin Quick II alters primary substrate specificity. Biochemistry. 1989 Mar 7;28(5):2078-82. [PubMed
]
- Degen SJ, Davie EW: Nucleotide sequence of the gene for human prothrombin. Biochemistry. 1987 Sep 22;26(19):6165-77. [PubMed
]
- 3242619 Henriksen RA, Mann KG: Identification of the primary structural defect in the dysthrombin thrombin Quick I: substitution of cysteine for arginine-382. Biochemistry. 1988 Dec 27;27(26):9160-5.
- 3567158 Miyata T, Morita T, Inomoto T, Kawauchi S, Shirakami A, Iwanaga S: Prothrombin Tokushima, a replacement of arginine-418 by tryptophan that impairs the fibrinogen clotting activity of derived thrombin Tokushima. Biochemistry. 1987 Feb 24;26(4):1117-22.
- 3759958 Rabiet MJ, Blashill A, Furie B, Furie BC: Prothrombin fragment 1 X 2 X 3, a major product of prothrombin activation in human plasma. J Biol Chem. 1986 Oct 5;261(28):13210-5.
- 3771562 Rabiet MJ, Furie BC, Furie B: Molecular defect of prothrombin Barcelona. Substitution of cysteine for arginine at residue 273. J Biol Chem. 1986 Nov 15;261(32):15045-8.
- 3801671 Inomoto T, Shirakami A, Kawauchi S, Shigekiyo T, Saito S, Miyoshi K, Morita T, Iwanaga S: Prothrombin Tokushima: characterization of dysfunctional thrombin derived from a variant of human prothrombin. Blood. 1987 Feb;69(2):565-9.
- 6305407 Degen SJ, MacGillivray RT, Davie EW: Characterization of the complementary deoxyribonucleic acid and gene coding for human prothrombin. Biochemistry. 1983 Apr 26;22(9):2087-97.
- 6405779 Board PG, Shaw DC: Determination of the amino acid substitution in human prothrombin type 3 (157 Glu leads to Lys) and the localization of a third thrombin cleavage site. Br J Haematol. 1983 Jun;54(2):245-54.
- 7792730 Degen SJ, McDowell SA, Sparks LM, Scharrer I: Prothrombin Frankfurt: a dysfunctional prothrombin characterized by substitution of Glu-466 by Ala. Thromb Haemost. 1995 Feb;73(2):203-9.
- 7865694 James HL, Kim DJ, Zheng DQ, Girolami A: Prothrombin Padua I: incomplete activation due to an amino acid substitution at a factor Xa cleavage site. Blood Coagul Fibrinolysis. 1994 Oct;5(5):841-4.
- 8071320 Rydel TJ, Yin M, Padmanabhan KP, Blankenship DT, Cardin AD, Correa PE, Fenton JW 2nd, Tulinsky A: Crystallographic structure of human gamma-thrombin. J Biol Chem. 1994 Sep 2;269(35):22000-6.
- 873923 Butkowski RJ, Elion J, Downing MR, Mann KG: Primary structure of human prethrombin 2 and alpha-thrombin. J Biol Chem. 1977 Jul 25;252(14):4942-57.
- 9214615 van de Locht A, Bode W, Huber R, Le Bonniec BF, Stone SR, Esmon CT, Stubbs MT: The thrombin E192Q-BPTI complex reveals gross structural rearrangements: implications for the interaction with antithrombin and thrombomodulin. EMBO J. 1997 Jun 2;16(11):2977-84.
|
| Target 1 Drug References |
- Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed
]
|
|
Drug Target 2
[top]
|
| Target 2 ID |
787 |
| Target 2 Name |
Vitamin K epoxide reductase complex subunit 1 |
| Target 2 Synonyms |
- EC 1.1.4.1
- Vitamin K1 2,3-epoxide reductase subunit 1
|
| Target 2 Gene Name |
VKORC1 |
| Target 2 Protein Sequence |
>Vitamin K epoxide reductase complex subunit 1
MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWG
RGFGLVEHVLGQDSILNQSNSIFGCIFYTLQLLLGCLRTRWASVLMLLSSLVSLAGSVYL
AWILFFVLYDFCIVCITTYAINVSLMWLSFRKVQEPQGKAKRH
|
| Target 2 Number of Residues |
165 |
| Target 2 Molecular Weight |
18235 |
| Target 2 Theoretical pI |
9.58 |
| Target 2 GO Classification |
Not Available |
| Target 2 General Function |
Involved in vitamin-K-epoxide reductase (warfarin-sensitive) activity |
| Target 2 Specific Function |
Involved in vitamin K metabolism. Catalytic subunit of the vitamin K epoxide reductase (VKOR) complex which reduces inactive vitamin K 2,3-epoxide to active vitamin K |
| Target 2 Pathways |
| Name |
SMPDB Link |
KEGG Link |
| Biosynthesis of steroids |
|
map00100  |
|
| Target 2 Reactions |
- 2-methyl-3-phytyl-1,4-naphthoquinone + oxidized dithiothreitol = 2,3-epoxy-2,3-dihydro-2-methyl-3-phytyl-1,4-naphthoquinone + 1,4-dithiothreitol
|
| Target 2 Pfam Domain Function |
|
| Target 2 Signals |
|
| Target 2 Transmembrane Regions |
|
| Target 2 Essentiality |
Non-Essential |
| Target 2 GenBank ID Protein |
40217983  |
| Target 2 UniProtKB/Swiss-Prot ID |
Q9BQB6  |
| Target 2 UniProtKB/Swiss-Prot Entry Name |
VKOR1_HUMAN  |
| Target 2 PDB ID |
Not Available |
| Target 2 Cellular Location |
- Endoplasmic reticulum
- endoplasmic reticulum membrane
- multi-pass membrane protein
|
| Target 2 Gene Sequence |
>492 bp
ATGGGCAGCACCTGGGGGAGCCCTGGCTGGGTGCGGCTCGCTCTTTGCCTGACGGGCTTA
GTGCTCTCGCTCTACGCGCTGCACGTGAAGGCGGCGCGCGCCCGGGACCGGGATTACCGC
GCGCTCTGCGACGTGGGCACCGCCATCAGCTGTTCGCGCGTCTTCTCCTCCAGGTGGGGC
AGGGGTTTCGGGCTGGTGGAGCATGTGCTGGGACAGGACAGCATCCTCAATCAATCCAAC
AGCATATTCGGTTGCATCTTCTACACACTACAGCTATTGTTAGGTTGCCTGCGGACACGC
TGGGCCTCTGTCCTGATGCTGCTGAGCTCCCTGGTGTCTCTCGCTGGTTCTGTCTACCTG
GCCTGGATCCTGTTCTTCGTGCTCTATGATTTCTGCATTGTTTGTATCACCACCTATGCT
ATCAACGTGAGCCTGATGTGGCTCAGTTTCCGGAAGGTCCAAGAACCCCAGGGCAAGGCT
AAGAGGCACTGA
|
| Target 2 GenBank Gene ID |
|
| Target 2 GeneCard ID |
VKORC1  |
| Target 2 GenAtlas ID |
VKORC1  |
| Target 2 HGNC ID |
HGNC:23663  |
| Target 2 Chromosome Location |
16 |
| Target 2 Locus |
16p11.2 |
| Target 2 SNPs |
SNPJam Report  |
| Target 2 General References |
- Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [PubMed
]
|
| Target 2 Drug References |
- Fukuda T, Tanabe T, Ohno M, Tougou K, Fujio Y, Azuma J, Yamamoto I, Takeda A: Warfarin dose requirement for patients with both VKORC1 3673A/A and CYP2C9*3/*3 genotypes. Clin Pharmacol Ther. 2006 Nov;80(5):553-4. [PubMed
]
- Yin T, Miyata T: Warfarin dose and the pharmacogenomics of CYP2C9 and VKORC1 - rationale and perspectives. Thromb Res. 2007;120(1):1-10. Epub 2006 Dec 11. [PubMed
]
- Osman A, Enstrom C, Lindahl TL: Plasma S/R ratio of warfarin co-varies with VKORC1 haplotype. Blood Coagul Fibrinolysis. 2007 Apr;18(3):293-6. [PubMed
]
- Zhu Y, Shennan M, Reynolds KK, Johnson NA, Herrnberger MR, Valdes R Jr, Linder MW: Estimation of warfarin maintenance dose based on VKORC1 (-1639 G>A) and CYP2C9 genotypes. Clin Chem. 2007 Jul;53(7):1199-205. Epub 2007 May 17. [PubMed
]
- Limdi NA, McGwin G, Goldstein JA, Beasley TM, Arnett DK, Adler BK, Baird MF, Acton RT: Influence of CYP2C9 and VKORC1 1173C/T Genotype on the Risk of Hemorrhagic Complications in African-American and European-American Patients on Warfarin. Clin Pharmacol Ther. 2007 Jul 25;. [PubMed
]
|
|
Drug Target 3
[top]
|
| Target 3 ID |
4081 |
| Target 3 Name |
Vitamin K epoxide reductase complex subunit 1-like protein 1 |
| Target 3 Synonyms |
- VKORC1- like protein 1
|
| Target 3 Gene Name |
VKORC1L1 |
| Target 3 Protein Sequence |
>Vitamin K epoxide reductase complex subunit 1-like protein 1
MAAPVLLRVSVPRWERVARYAVCAAGILLSIYAYHVEREKERDPEHRALCDLGPWVKCSA
ALASRWGRGFGLLGSIFGKDGVLNQPNSVFGLIFYILQLLLGMTASAVAALILMTSSIMS
VVGSLYLAYILYFVLKEFCIICIVTYVLNFLLLIINYKRLVYLNEAWKRQLQPKQD
|
| Target 3 Number of Residues |
178 |
| Target 3 Molecular Weight |
19836 |
| Target 3 Theoretical pI |
9.35 |
| Target 3 GO Classification |
Not Available |
| Target 3 General Function |
Not Available |
| Target 3 Specific Function |
Not Available |
| Target 3 Pathways |
Not Available
|
| Target 3 Reactions |
Not Available |
| Target 3 Pfam Domain Function |
|
| Target 3 Signals |
|
| Target 3 Transmembrane Regions |
- 17-37
- 92-112
- 114-134
- 135-155
|
| Target 3 Essentiality |
Non Essential |
| Target 3 GenBank ID Protein |
40217985  |
| Target 3 UniProtKB/Swiss-Prot ID |
Q8N0U8  |
| Target 3 UniProtKB/Swiss-Prot Entry Name |
VKORL_HUMAN  |
| Target 3 PDB ID |
Not Available |
| Target 3 Cellular Location |
|
| Target 3 Gene Sequence |
>531 bp
ATGGCGGCTCCCGTCCTGCTAAGAGTGTCGGTGCCGCGGTGGGAGCGGGTGGCCCGGTAT
GCAGTGTGCGCTGCCGGAATCCTGCTCTCCATCTACGCCTACCACGTGGAGCGGGAGAAG
GAGCGGGACCCCGAGCACCGGGCCCTCTGCGACCTGGGGCCCTGGGTGAAGTGCTCCGCC
GCCCTTGCCTCCAGATGGGGTCGAGGATTTGGTCTTTTGGGTTCCATTTTTGGAAAGGAT
GGTGTATTAAACCAGCCAAACAGTGTCTTTGGACTTATATTTTATATACTACAGTTATTA
CTTGGCATGACAGCAAGCGCTGTGGCGGCTTTGATCCTCATGACGTCCTCCATCATGTCG
GTCGTGGGGTCCCTGTACCTGGCCTACATTCTGTACTTTGTGCTGAAGGAGTTCTGCATC
ATCTGCATCGTCACGTACGTGCTGAACTTCCTTCTTCTCATTATCAACTACAAACGACTA
GTTTACTTGAACGAGGCCTGGAAGCGGCAGCTGCAACCCAAGCAGGACTGA
|
| Target 3 GenBank Gene ID |
|
| Target 3 GeneCard ID |
VKORC1L1  |
| Target 3 GenAtlas ID |
VKORC1L1  |
| Target 3 HGNC ID |
HGNC:21492  |
| Target 3 Chromosome Location |
7 |
| Target 3 Locus |
7q11.21 |
| Target 3 SNPs |
SNPJam Report  |
| Target 3 General References |
Not Available |
| Target 3 Drug References |
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
|