You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NamePramlintide
Accession NumberDB01278
TypeBiotech
GroupsApproved, Investigational
DescriptionPramlintide is a relatively new adjunct treatment for diabetes (both type 1 and 2), developed by Amylin Pharmaceuticals. It is derived from amylin, a hormone that is released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes.
Protein structureNo structure small
Related Articles
Protein chemical formulaC171H267N51O53S2
Protein average weight3949.3896 Da
Sequences
>Pramlintide
KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY
Download FASTA Format
SynonymsNot Available
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Symlinpeninjection1000 ug/mLsubcutaneousAstra Zeneca Pharmaceuticals Lp2015-01-08Not applicableUs
Symlinpeninjection1000 ug/mLsubcutaneousAstra Zeneca Pharmaceuticals Lp2015-01-08Not applicableUs
Symlinpeninjection1000 ug/mLsubcutaneousAmylin Pharmaceuticals, LLC2005-03-16Not applicableUs
Symlinpeninjection1000 ug/mLsubcutaneousAmylin Pharmaceuticals, LLC2005-03-16Not applicableUs
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International Brands
NameCompany
SymlinAmylin Pharmaceuticals
Brand mixturesNot Available
Salts
Name/CASStructureProperties
Pramlintide acetate
Thumb
  • InChI Key:
  • Monoisotopic Mass:
  • Average Mass:
DBSALT000144
Categories
UNIID3FM8FA78T
CAS number151126-32-8
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationFor the treatment of type 1 and type 2 diabetes mellitus as an adjunct to preprandial insulin therapy in patients without adequate glycemic control of insulin therapy.
PharmacodynamicsPramlintide is a synthetic analog of amylin, a glucoregulatory hormone that is synthesized by pancreatic β-cells and released into the bloodstream, in a similar pattern as insulin, after a meal. Like insulin, amylin is deficient in individuals with diabetes. It is provided as an acetate salt. Pramlintide is a 37-amino acid polypeptide that differs structurally from human amylin by the replacement of alanine, serine, and serine at positions 25, 28, and 29 respectively with proline.
Mechanism of actionPramlintide is an amlyinomimetic, a functional analog of the naturally occurring pancreatic hormone amylin. Amylin has activity in a number of gastrointestinal and glucodynamic systems, and by mimicking its activity, pramlintide acts to improve glycemic control through modulation of the rate of gastric emptying, prevention of post-prandial rise in glucagon levels, and by increasing sensations of satiety, thereby reducing caloric intake and potentiating weight loss. There appears to be at least three distinct receptor complexes that bind with high affinity to amylin. All three complexes contain the calcitonin receptor at the core, plus one of three Receptor activity-modifying proteins, RAMP1, RAMP2, or RAMP3.
Related Articles
AbsorptionThe absolute bioavailability of a single subcutaneous dose of pramlintide is approximately 30 to 40%.
Volume of distributionNot Available
Protein bindingPramlintide does not extensively bind to blood cells or albumin (approximately 40% of the drug is unbound in plasma).
Metabolism

Metabolized primarily by the kidneys.

Route of eliminationPramlintide is metabolized primarily by the kidneys.
Half lifeApproximately 48 minutes
ClearanceNot Available
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Injectionsubcutaneous1000 ug/mL
Prices
Unit descriptionCostUnit
Symlin 600 mcg/ml Solution 5ml Vial227.69USD vial
SymlinPen 120 1000 mcg/ml Solution Two 2.7ml Syringes Per Box168.85USD syringe
Symlinpen 60 pen injector123.51USD ml
Symlin 0.6 mg/ml vial49.35USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
US5686411 No1999-03-162019-03-16Us
US5814600 No1995-09-292015-09-29Us
US6114304 No1997-09-052017-09-05Us
US6610824 No1994-03-032011-03-03Us
Properties
StateLiquid
Experimental PropertiesNot Available
References
Synthesis Reference

Andreas Brunner, Oleg Werbitzky, Stephane Varray, Francesca Quattrini, Holger Hermann, Andrew Strong, Fernando Albericio, Judit Tulla-Puche, Yesica Garcia Ramos, “PROCESS FOR THE PRODUCTION OF PRAMLINTIDE.” U.S. Patent US20100249370, issued September 30, 2010.

US20100249370
General References
  1. Jones MC: Therapies for diabetes: pramlintide and exenatide. Am Fam Physician. 2007 Jun 15;75(12):1831-5. [PubMed:17619527 ]
  2. Ryan GJ, Jobe LJ, Martin R: Pramlintide in the treatment of type 1 and type 2 diabetes mellitus. Clin Ther. 2005 Oct;27(10):1500-12. [PubMed:16330288 ]
  3. Edelman S, Maier H, Wilhelm K: Pramlintide in the treatment of diabetes mellitus. BioDrugs. 2008;22(6):375-86. doi: 10.2165/0063030-200822060-00004. [PubMed:18998755 ]
  4. Kleppinger EL, Vivian EM: Pramlintide for the treatment of diabetes mellitus. Ann Pharmacother. 2003 Jul-Aug;37(7-8):1082-9. [PubMed:12841822 ]
External Links
ATC CodesA10BX05
AHFS CodesNot Available
PDB EntriesNot Available
FDA labelDownload (856 KB)
MSDSNot Available
Interactions
Drug Interactions
Drug
7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE may increase the hypoglycemic activities of Pramlintide.
Acetylsalicylic acidAcetylsalicylic acid may increase the hypoglycemic activities of Pramlintide.
AclidiniumPramlintide may increase the anticholinergic activities of Aclidinium.
Aminosalicylic AcidAminosalicylic Acid may increase the hypoglycemic activities of Pramlintide.
AmoxapineAmoxapine may increase the hypoglycemic activities of Pramlintide.
Anisotropine MethylbromidePramlintide may increase the anticholinergic activities of Anisotropine Methylbromide.
AripiprazoleThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Aripiprazole.
Arsenic trioxideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Arsenic trioxide.
ArticaineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Articaine.
AsenapineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Asenapine.
AtazanavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Atazanavir.
Atracurium besylatePramlintide may increase the anticholinergic activities of Atracurium besylate.
AtropinePramlintide may increase the anticholinergic activities of Atropine.
BenactyzinePramlintide may increase the anticholinergic activities of Benactyzine.
BendroflumethiazideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Bendroflumethiazide.
BenmoxinBenmoxin may increase the hypoglycemic activities of Pramlintide.
BenzatropinePramlintide may increase the anticholinergic activities of Benzatropine.
BetamethasoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Betamethasone.
BiperidenPramlintide may increase the anticholinergic activities of Biperiden.
BrexpiprazoleThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Brexpiprazole.
BumetanideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Bumetanide.
BuserelinThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Buserelin.
CaroxazoneCaroxazone may increase the hypoglycemic activities of Pramlintide.
CeritinibThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Ceritinib.
ChlorothiazideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Chlorothiazide.
ChlorphenoxaminePramlintide may increase the anticholinergic activities of Chlorphenoxamine.
ChlorpropamidePramlintide may increase the hypoglycemic activities of Chlorpropamide.
ChlorthalidoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Chlorthalidone.
CitalopramCitalopram may increase the hypoglycemic activities of Pramlintide.
ClomipramineClomipramine may increase the hypoglycemic activities of Pramlintide.
ClozapineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Clozapine.
CorticotropinThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Corticotropin.
Cortisone acetateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Cortisone acetate.
CyclopentolatePramlintide may increase the anticholinergic activities of Cyclopentolate.
Cyproterone acetateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Cyproterone acetate.
DabrafenibThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Dabrafenib.
DanazolThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Danazol.
DapoxetineDapoxetine may increase the hypoglycemic activities of Pramlintide.
DarifenacinPramlintide may increase the anticholinergic activities of Darifenacin.
DarunavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Darunavir.
DesloratadinePramlintide may increase the anticholinergic activities of Desloratadine.
DesogestrelThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Desogestrel.
DexamethasoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Dexamethasone.
DexetimidePramlintide may increase the anticholinergic activities of Dexetimide.
DiazoxideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Diazoxide.
DicyclominePramlintide may increase the anticholinergic activities of Dicyclomine.
DienogestThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Dienogest.
DiflunisalDiflunisal may increase the hypoglycemic activities of Pramlintide.
DihydrotestosteroneDihydrotestosterone may increase the hypoglycemic activities of Pramlintide.
DisopyramidePramlintide may increase the hypoglycemic activities of Disopyramide.
DrospirenoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Drospirenone.
EpinephrineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Epinephrine.
EscitalopramEscitalopram may increase the hypoglycemic activities of Pramlintide.
EstradiolThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Estradiol.
Estrone sulfateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Estrone sulfate.
Etacrynic acidThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Etacrynic acid.
Ethinyl EstradiolThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Ethinyl Estradiol.
EthopropazinePramlintide may increase the anticholinergic activities of Ethopropazine.
Ethynodiol diacetateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Ethynodiol diacetate.
EtonogestrelThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Etonogestrel.
EtoperidoneEtoperidone may increase the hypoglycemic activities of Pramlintide.
EverolimusThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Everolimus.
FenfluramineFenfluramine may increase the hypoglycemic activities of Pramlintide.
FesoterodinePramlintide may increase the anticholinergic activities of Fesoterodine.
FludrocortisoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Fludrocortisone.
FluoxetineFluoxetine may increase the hypoglycemic activities of Pramlintide.
FluoxymesteroneFluoxymesterone may increase the hypoglycemic activities of Pramlintide.
FluvoxamineFluvoxamine may increase the hypoglycemic activities of Pramlintide.
FosamprenavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Fosamprenavir.
FurazolidoneFurazolidone may increase the hypoglycemic activities of Pramlintide.
FurosemideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Furosemide.
Gallamine TriethiodidePramlintide may increase the anticholinergic activities of Gallamine Triethiodide.
GliclazidePramlintide may increase the hypoglycemic activities of Gliclazide.
GlimepiridePramlintide may increase the hypoglycemic activities of Glimepiride.
GlipizidePramlintide may increase the hypoglycemic activities of Glipizide.
GlyburidePramlintide may increase the hypoglycemic activities of Glyburide.
GlycopyrroniumPramlintide may increase the anticholinergic activities of Glycopyrronium.
GoserelinThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Goserelin.
HexamethoniumPramlintide may increase the anticholinergic activities of Hexamethonium.
HistrelinThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Histrelin.
HomatropinePramlintide may increase the anticholinergic activities of Homatropine.
HydracarbazineHydracarbazine may increase the hypoglycemic activities of Pramlintide.
HydrochlorothiazideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Hydrochlorothiazide.
HydrocortisoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Hydrocortisone.
HydroflumethiazideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Hydroflumethiazide.
Hydroxyprogesterone caproateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Hydroxyprogesterone caproate.
HyoscyaminePramlintide may increase the anticholinergic activities of Hyoscyamine.
IloperidoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Iloperidone.
IndalpineIndalpine may increase the hypoglycemic activities of Pramlintide.
IndapamideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Indapamide.
IndinavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Indinavir.
Insulin AspartPramlintide may increase the hypoglycemic activities of Insulin Aspart.
Insulin DetemirPramlintide may increase the hypoglycemic activities of Insulin Detemir.
Insulin GlarginePramlintide may increase the hypoglycemic activities of Insulin Glargine.
Insulin GlulisinePramlintide may increase the hypoglycemic activities of Insulin Glulisine.
Insulin HumanPramlintide may increase the hypoglycemic activities of Insulin Human.
Insulin LisproPramlintide may increase the hypoglycemic activities of Insulin Lispro.
Insulin PorkPramlintide may increase the hypoglycemic activities of Insulin Pork.
Ipratropium bromidePramlintide may increase the anticholinergic activities of Ipratropium bromide.
IproclozideIproclozide may increase the hypoglycemic activities of Pramlintide.
IproniazidIproniazid may increase the hypoglycemic activities of Pramlintide.
IsocarboxazidIsocarboxazid may increase the hypoglycemic activities of Pramlintide.
LanreotideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Lanreotide.
LanreotidePramlintide may increase the hypoglycemic activities of Lanreotide.
LeuprolideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Leuprolide.
LevomilnacipranLevomilnacipran may increase the hypoglycemic activities of Pramlintide.
LevonorgestrelThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Levonorgestrel.
Lipoic AcidLipoic Acid may increase the hypoglycemic activities of Pramlintide.
LopinavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Lopinavir.
Lu AA21004Lu AA21004 may increase the hypoglycemic activities of Pramlintide.
LurasidoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Lurasidone.
MebanazineMebanazine may increase the hypoglycemic activities of Pramlintide.
MecamylaminePramlintide may increase the anticholinergic activities of Mecamylamine.
MecaserminPramlintide may increase the hypoglycemic activities of Mecasermin.
Medroxyprogesterone acetateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Medroxyprogesterone acetate.
Megestrol acetateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Megestrol acetate.
MesalazineMesalazine may increase the hypoglycemic activities of Pramlintide.
MestranolThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Mestranol.
MethanthelinePramlintide may increase the anticholinergic activities of Methantheline.
MethotrimeprazineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Methotrimeprazine.
MethyclothiazideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Methyclothiazide.
Methylene blueMethylene blue may increase the hypoglycemic activities of Pramlintide.
MethylprednisoloneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Methylprednisolone.
MethyltestosteroneMethyltestosterone may increase the hypoglycemic activities of Pramlintide.
MetixenePramlintide may increase the anticholinergic activities of Metixene.
MetolazoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Metolazone.
MifepristonePramlintide may increase the hypoglycemic activities of Mifepristone.
MilnacipranMilnacipran may increase the hypoglycemic activities of Pramlintide.
MinaprineMinaprine may increase the hypoglycemic activities of Pramlintide.
MoclobemideMoclobemide may increase the hypoglycemic activities of Pramlintide.
N-butylscopolammonium bromidePramlintide may increase the anticholinergic activities of N-butylscopolammonium bromide.
NateglinidePramlintide may increase the hypoglycemic activities of Nateglinide.
NelfinavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Nelfinavir.
NiacinThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Niacin.
NialamideNialamide may increase the hypoglycemic activities of Pramlintide.
NilotinibThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Nilotinib.
NorethisteroneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Norethisterone.
NorgestimateThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Norgestimate.
NVA237Pramlintide may increase the anticholinergic activities of NVA237.
OctamoxinOctamoxin may increase the hypoglycemic activities of Pramlintide.
OctreotideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Octreotide.
OctreotidePramlintide may increase the hypoglycemic activities of Octreotide.
OlanzapineOlanzapine may increase the hypoglycemic activities of Pramlintide.
OrphenadrinePramlintide may increase the anticholinergic activities of Orphenadrine.
OxandroloneOxandrolone may increase the hypoglycemic activities of Pramlintide.
OxybutyninPramlintide may increase the anticholinergic activities of Oxybutynin.
OxymetholoneOxymetholone may increase the hypoglycemic activities of Pramlintide.
OxyphenoniumPramlintide may increase the anticholinergic activities of Oxyphenonium.
PaliperidoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Paliperidone.
PancuroniumPramlintide may increase the anticholinergic activities of Pancuronium.
PargylinePargyline may increase the hypoglycemic activities of Pramlintide.
ParoxetineParoxetine may increase the hypoglycemic activities of Pramlintide.
PasireotideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Pasireotide.
PasireotidePramlintide may increase the hypoglycemic activities of Pasireotide.
PegvisomantPegvisomant may increase the hypoglycemic activities of Pramlintide.
PentamidineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Pentamidine.
PentamidinePramlintide may increase the hypoglycemic activities of Pentamidine.
PentoliniumPramlintide may increase the anticholinergic activities of Pentolinium.
PhenelzinePhenelzine may increase the hypoglycemic activities of Pramlintide.
PheniprazinePheniprazine may increase the hypoglycemic activities of Pramlintide.
PhenoxypropazinePhenoxypropazine may increase the hypoglycemic activities of Pramlintide.
PipecuroniumPramlintide may increase the anticholinergic activities of Pipecuronium.
PiperazineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Piperazine.
PipotiazineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Pipotiazine.
PirenzepinePramlintide may increase the anticholinergic activities of Pirenzepine.
PirlindolePirlindole may increase the hypoglycemic activities of Pramlintide.
PivhydrazinePivhydrazine may increase the hypoglycemic activities of Pramlintide.
PolythiazideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Polythiazide.
PrednisoloneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Prednisolone.
PrednisoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Prednisone.
ProcyclidinePramlintide may increase the anticholinergic activities of Procyclidine.
ProgesteroneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Progesterone.
PropanthelinePramlintide may increase the anticholinergic activities of Propantheline.
QuetiapineThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Quetiapine.
QuinethazoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Quinethazone.
QuinidinePramlintide may increase the anticholinergic activities of Quinidine.
QuininePramlintide may increase the hypoglycemic activities of Quinine.
RasagilineRasagiline may increase the hypoglycemic activities of Pramlintide.
RepaglinidePramlintide may increase the hypoglycemic activities of Repaglinide.
RisperidoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Risperidone.
RitonavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Ritonavir.
SafrazineSafrazine may increase the hypoglycemic activities of Pramlintide.
Salicylic acidSalicylic acid may increase the hypoglycemic activities of Pramlintide.
SaquinavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Saquinavir.
ScopolaminePramlintide may increase the anticholinergic activities of Scopolamine.
Scopolamine butylbromidePramlintide may increase the anticholinergic activities of Scopolamine butylbromide.
SelegilineSelegiline may increase the hypoglycemic activities of Pramlintide.
SertralineSertraline may increase the hypoglycemic activities of Pramlintide.
SirolimusThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Sirolimus.
SolifenacinPramlintide may increase the anticholinergic activities of Solifenacin.
StanozololStanozolol may increase the hypoglycemic activities of Pramlintide.
SulfadiazinePramlintide may increase the hypoglycemic activities of Sulfadiazine.
SulfamethoxazolePramlintide may increase the hypoglycemic activities of Sulfamethoxazole.
SulfisoxazolePramlintide may increase the hypoglycemic activities of Sulfisoxazole.
SunitinibPramlintide may increase the hypoglycemic activities of Sunitinib.
TacrolimusThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Tacrolimus.
TemsirolimusThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Temsirolimus.
TestosteroneTestosterone may increase the hypoglycemic activities of Pramlintide.
TiotropiumPramlintide may increase the anticholinergic activities of Tiotropium.
TipranavirThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Tipranavir.
TolazamidePramlintide may increase the hypoglycemic activities of Tolazamide.
TolbutamidePramlintide may increase the hypoglycemic activities of Tolbutamide.
ToloxatoneToloxatone may increase the hypoglycemic activities of Pramlintide.
TolterodinePramlintide may increase the anticholinergic activities of Tolterodine.
TorasemideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Torasemide.
Trans-2-PhenylcyclopropylamineTrans-2-Phenylcyclopropylamine may increase the hypoglycemic activities of Pramlintide.
TranylcypromineTranylcypromine may increase the hypoglycemic activities of Pramlintide.
TrazodoneTrazodone may increase the hypoglycemic activities of Pramlintide.
TriamcinoloneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Triamcinolone.
TrichlormethiazideThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Trichlormethiazide.
TrihexyphenidylPramlintide may increase the anticholinergic activities of Trihexyphenidyl.
TrimethaphanPramlintide may increase the anticholinergic activities of Trimethaphan.
TriptorelinThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Triptorelin.
TropicamidePramlintide may increase the anticholinergic activities of Tropicamide.
TrospiumPramlintide may increase the anticholinergic activities of Trospium.
TubocurarinePramlintide may increase the anticholinergic activities of Tubocurarine.
UmeclidiniumPramlintide may increase the anticholinergic activities of Umeclidinium.
VecuroniumPramlintide may increase the anticholinergic activities of Vecuronium.
VilazodoneVilazodone may increase the hypoglycemic activities of Pramlintide.
VorinostatThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Vorinostat.
VortioxetineVortioxetine may increase the hypoglycemic activities of Pramlintide.
ZimelidineZimelidine may increase the hypoglycemic activities of Pramlintide.
ZiprasidoneThe therapeutic efficacy of Pramlintide can be decreased when used in combination with Ziprasidone.
Food InteractionsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Receptor activity
Specific Function:
This is a receptor for calcitonin. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The calcitonin receptor is thought to couple to the heterotrimeric guanosine triphosphate-binding protein that is sensitive to cholera toxin.
Gene Name:
CALCR
Uniprot ID:
P30988
Molecular Weight:
59351.865 Da
References
  1. Nyholm B, Brock B, Orskov L, Schmitz O: Amylin receptor agonists: a novel pharmacological approach in the management of insulin-treated diabetes mellitus. Expert Opin Investig Drugs. 2001 Sep;10(9):1641-52. [PubMed:11772274 ]
  2. Roth JD, Maier H, Chen S, Roland BL: Implications of amylin receptor agonism: integrated neurohormonal mechanisms and therapeutic applications. Arch Neurol. 2009 Mar;66(3):306-10. doi: 10.1001/archneurol.2008.581. [PubMed:19273748 ]
  3. Lutz TA: The role of amylin in the control of energy homeostasis. Am J Physiol Regul Integr Comp Physiol. 2010 Jun;298(6):R1475-84. doi: 10.1152/ajpregu.00703.2009. Epub 2010 Mar 31. [PubMed:20357016 ]
  4. Qi T, Hay DL: Structure-function relationships of the N-terminus of receptor activity-modifying proteins. Br J Pharmacol. 2010 Mar;159(5):1059-68. doi: 10.1111/j.1476-5381.2009.00541.x. Epub 2009 Dec 10. [PubMed:20015292 ]
  5. Qi T, Christopoulos G, Bailey RJ, Christopoulos A, Sexton PM, Hay DL: Identification of N-terminal receptor activity-modifying protein residues important for calcitonin gene-related peptide, adrenomedullin, and amylin receptor function. Mol Pharmacol. 2008 Oct;74(4):1059-71. doi: 10.1124/mol.108.047142. Epub 2008 Jul 1. [PubMed:18593822 ]
  6. Hay DL, Christopoulos G, Christopoulos A, Sexton PM: Amylin receptors: molecular composition and pharmacology. Biochem Soc Trans. 2004 Nov;32(Pt 5):865-7. [PubMed:15494035 ]
Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Receptor activity
Specific Function:
Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. Acts as a receptor for calcitonin-gene-related peptide (CGRP) together with CALCRL.
Gene Name:
RAMP1
Uniprot ID:
O60894
Molecular Weight:
16987.765 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
  3. Nyholm B, Brock B, Orskov L, Schmitz O: Amylin receptor agonists: a novel pharmacological approach in the management of insulin-treated diabetes mellitus. Expert Opin Investig Drugs. 2001 Sep;10(9):1641-52. [PubMed:11772274 ]
  4. Roth JD, Maier H, Chen S, Roland BL: Implications of amylin receptor agonism: integrated neurohormonal mechanisms and therapeutic applications. Arch Neurol. 2009 Mar;66(3):306-10. doi: 10.1001/archneurol.2008.581. [PubMed:19273748 ]
  5. Lutz TA: The role of amylin in the control of energy homeostasis. Am J Physiol Regul Integr Comp Physiol. 2010 Jun;298(6):R1475-84. doi: 10.1152/ajpregu.00703.2009. Epub 2010 Mar 31. [PubMed:20357016 ]
  6. Qi T, Hay DL: Structure-function relationships of the N-terminus of receptor activity-modifying proteins. Br J Pharmacol. 2010 Mar;159(5):1059-68. doi: 10.1111/j.1476-5381.2009.00541.x. Epub 2009 Dec 10. [PubMed:20015292 ]
  7. Qi T, Christopoulos G, Bailey RJ, Christopoulos A, Sexton PM, Hay DL: Identification of N-terminal receptor activity-modifying protein residues important for calcitonin gene-related peptide, adrenomedullin, and amylin receptor function. Mol Pharmacol. 2008 Oct;74(4):1059-71. doi: 10.1124/mol.108.047142. Epub 2008 Jul 1. [PubMed:18593822 ]
  8. Hay DL, Christopoulos G, Christopoulos A, Sexton PM: Amylin receptors: molecular composition and pharmacology. Biochem Soc Trans. 2004 Nov;32(Pt 5):865-7. [PubMed:15494035 ]
Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Protein transporter activity
Specific Function:
Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. Acts as a receptor for adrenomedullin (AM) together with CALCRL.
Gene Name:
RAMP2
Uniprot ID:
O60895
Molecular Weight:
19607.44 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
  3. Roth JD, Maier H, Chen S, Roland BL: Implications of amylin receptor agonism: integrated neurohormonal mechanisms and therapeutic applications. Arch Neurol. 2009 Mar;66(3):306-10. doi: 10.1001/archneurol.2008.581. [PubMed:19273748 ]
  4. Qi T, Hay DL: Structure-function relationships of the N-terminus of receptor activity-modifying proteins. Br J Pharmacol. 2010 Mar;159(5):1059-68. doi: 10.1111/j.1476-5381.2009.00541.x. Epub 2009 Dec 10. [PubMed:20015292 ]
  5. Qi T, Christopoulos G, Bailey RJ, Christopoulos A, Sexton PM, Hay DL: Identification of N-terminal receptor activity-modifying protein residues important for calcitonin gene-related peptide, adrenomedullin, and amylin receptor function. Mol Pharmacol. 2008 Oct;74(4):1059-71. doi: 10.1124/mol.108.047142. Epub 2008 Jul 1. [PubMed:18593822 ]
  6. Hay DL, Christopoulos G, Christopoulos A, Sexton PM: Amylin receptors: molecular composition and pharmacology. Biochem Soc Trans. 2004 Nov;32(Pt 5):865-7. [PubMed:15494035 ]
Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Receptor activity
Specific Function:
Plays a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) and GPER1 to the plasma membrane. Acts as a receptor for adrenomedullin (AM) together with CALCRL.
Gene Name:
RAMP3
Uniprot ID:
O60896
Molecular Weight:
16518.325 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
  3. Nyholm B, Brock B, Orskov L, Schmitz O: Amylin receptor agonists: a novel pharmacological approach in the management of insulin-treated diabetes mellitus. Expert Opin Investig Drugs. 2001 Sep;10(9):1641-52. [PubMed:11772274 ]
  4. Roth JD, Maier H, Chen S, Roland BL: Implications of amylin receptor agonism: integrated neurohormonal mechanisms and therapeutic applications. Arch Neurol. 2009 Mar;66(3):306-10. doi: 10.1001/archneurol.2008.581. [PubMed:19273748 ]
  5. Lutz TA: The role of amylin in the control of energy homeostasis. Am J Physiol Regul Integr Comp Physiol. 2010 Jun;298(6):R1475-84. doi: 10.1152/ajpregu.00703.2009. Epub 2010 Mar 31. [PubMed:20357016 ]
  6. Qi T, Hay DL: Structure-function relationships of the N-terminus of receptor activity-modifying proteins. Br J Pharmacol. 2010 Mar;159(5):1059-68. doi: 10.1111/j.1476-5381.2009.00541.x. Epub 2009 Dec 10. [PubMed:20015292 ]
  7. Qi T, Christopoulos G, Bailey RJ, Christopoulos A, Sexton PM, Hay DL: Identification of N-terminal receptor activity-modifying protein residues important for calcitonin gene-related peptide, adrenomedullin, and amylin receptor function. Mol Pharmacol. 2008 Oct;74(4):1059-71. doi: 10.1124/mol.108.047142. Epub 2008 Jul 1. [PubMed:18593822 ]
  8. Hay DL, Christopoulos G, Christopoulos A, Sexton PM: Amylin receptors: molecular composition and pharmacology. Biochem Soc Trans. 2004 Nov;32(Pt 5):865-7. [PubMed:15494035 ]
Comments
comments powered by Disqus
Drug created on May 16, 2007 16:15 / Updated on September 27, 2016 02:26