| Identification | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Name | Insulin Glargine | ||||||||||||||||||
| Accession Number | DB00047 (BIOD00045, BTD00045, DB01308) | ||||||||||||||||||
| Type | biotech | ||||||||||||||||||
| Groups | approved | ||||||||||||||||||
| Description | Insulin glargine is produced by recombinant DNA technology using a non-pathogenic laboratory strain of Escherichia coli (K12) as the production organism. It is an analogue of human insulin made by replacing the asparagine residue at position A21 of the A-chain with glycine and adding two arginines to the C-terminus (positions B31 and 32) of the B-chain. The resulting protein is soluble at pH 4 and forms microprecipitates at physiological pH 7.4. Small amounts of insulin glargine are slowly released from microprecipitates giving the drug a long duration of action and no pronounced peak concentration. |
||||||||||||||||||
| Protein structure |
Display: 3D Structure |
||||||||||||||||||
| Protein chemical formula | C267H408N72O77S6 | ||||||||||||||||||
| Protein average weight | 6063.0000 | ||||||||||||||||||
| Sequences |
>A chain GIVEQCCTSICSLYQLENYCG >B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR FASTA |
||||||||||||||||||
| Synonyms |
|
||||||||||||||||||
| Brand names |
|
||||||||||||||||||
| Brand name mixtures | Not Available | ||||||||||||||||||
| Categories |
|
||||||||||||||||||
| CAS number | 160337-95-1 | ||||||||||||||||||
| Taxonomy | |||||||||||||||||||
| Kingdom | Not Available | ||||||||||||||||||
| Classes | Not Available | ||||||||||||||||||
| Substructures | Not Available | ||||||||||||||||||
| Pharmacology | |||||||||||||||||||
| Indication | For the treatment of Type 1 or 2 diabetes mellitus in patients over 17 years old who require a long-acting (basal) insulin for the control of hyperglycemia. May be used in pediatric patients with Type 1 diabetes mellitus who require a long-acting (basal) insulin for glycemic control. | ||||||||||||||||||
| Pharmacodynamics | Insulin is a natural hormone produced by beta cells of the pancreas. In non-diabetic individuals, a basal level of insulin is supplemented with insulin spikes following meals. Increased insulin secretion following meals is responsible for the metabolic changes that occur as the body transitions from a postabsorptive to absorptive state. Insulin promotes cellular uptake of glucose, particularly in muscle and adipose tissues, promotes energy storage via glycogenesis, opposes catabolism of energy stores, increases DNA replication and protein synthesis by stimulating amino acid uptake by liver, muscle and adipose tissue, and modifies the activity of numerous enzymes involved in glycogen synthesis and glycolysis. Insulin also promotes growth and is required for the actions of growth hormone (e.g. protein synthesis, cell division, DNA synthesis). Insulin glargine is a long-acting insulin analogue with a flat and predictable action profile. It is used to mimic the basal levels of insulin in diabetic individuals. The onset of action of insulin glargine is approximately 90 minutes and its duration of action is up to 24 hours. | ||||||||||||||||||
| Mechanism of action | Insulin glargine binds to the insulin receptor (IR), a heterotetrameric protein consisting of two extracellular alpha units and two transmembrane beta units. The binding of insulin to the alpha subunit of IR stimulates the tyrosine kinase activity intrinsic to the beta subunit of the receptor. The bound receptor autophosphorylates and phosphorylates numerous intracellular substrates such as insulin receptor substrates (IRS) proteins, Cbl, APS, Shc and Gab 1. Activation of these proteins leads to the activation of downstream signaling molecules including PI3 kinase and Akt. Akt regulates the activity of glucose transporter 4 (GLUT4) and protein kinase C (PKC), both of which play critical roles in metabolism. Insulin glargine is completely soluble at pH 4, the pH of administered solution, and has low solubility at physiological pH 7.4. Upon subcuteous injection, the solution is neutralized resulting in the formation of microprecipitates. Small amounts of insulin glargine are released from microprecipitates giving the drug a relatively constant concentration over time profile over 24 hours with no pronounced peak. This release mechanism allows the drug to mimic basal insulin levels within the body. | ||||||||||||||||||
| Absorption | Forms microprecipitates following subcutaneous injection. Slow release of insulin glargine from microprecipitates provides a relatively constant concentration of insulin over 24 hours. Onset of action is approximately 1.1 hours. | ||||||||||||||||||
| Volume of distribution | Not Available | ||||||||||||||||||
| Protein binding | Not Available | ||||||||||||||||||
| Metabolism |
Partly metabolized to two active metabolites with similar in vitro activity to insulin: A21-Gly-insulin and A21-Gly-des-B30-Thr-insulin. |
||||||||||||||||||
| Route of elimination | Not Available | ||||||||||||||||||
| Half life | Not reported in humans; 30 hours in vitro in mammalian reticulocytes. | ||||||||||||||||||
| Clearance | Not Available | ||||||||||||||||||
| Toxicity | Inappropriately high dosages relative to food intake and/or energy expenditure may result in severe and sometimes prolonged and life-threatening hypoglycemia. Neurogenic (autonomic) signs and symptoms of hypoglycemia include trembling, palpitations, sweating, anxiety, hunger, nausea and tingling. Neuroglycopenic signs and symptoms of hypoglycemia include difficulty concentrating, lethargy/weakness, confusion, drowsiness, vision changes, difficulty speaking, headache, and dizziness. Mild hypoglycemia is characterized by the presence of autonomic symptoms. Moderate hypoglycemia is characterized by the presence of autonomic and neuroglycopenic symptoms. Individuals may become unconscious in severe cases of hypoglycemia. Other adverse events that may occur include allergic reaction, injection site reaction, lipodystrophy, pruritis, and rash. | ||||||||||||||||||
| Affected organisms |
|
||||||||||||||||||
| Pathways | Not Available | ||||||||||||||||||
| Pharmacoeconomics | |||||||||||||||||||
| Manufacturers |
|
||||||||||||||||||
| Packagers |
|
||||||||||||||||||
| Dosage forms |
|
||||||||||||||||||
| Prices |
|
||||||||||||||||||
| Patents |
|
||||||||||||||||||
| Properties | |||||||||||||||||||
| State | liquid | ||||||||||||||||||
| Melting point | 81 oC (Khachidze, D.G. et al., J. Biol. Phys. Chem. 1:64-67 (2001)) | ||||||||||||||||||
| Experimental Properties |
|
||||||||||||||||||
| References | |||||||||||||||||||
| Synthesis Reference | Not Available | ||||||||||||||||||
| General Reference |
|
||||||||||||||||||
| External Links |
|
||||||||||||||||||
| ATC Codes |
|
||||||||||||||||||
| AHFS Codes |
|
||||||||||||||||||
| PDB Entries | |||||||||||||||||||
| FDA label | show (51.2 KB) | ||||||||||||||||||
| MSDS | Not Available | ||||||||||||||||||
| Interactions | |||||||||||||||||||
| Drug Interactions | Not Available | ||||||||||||||||||
| Food Interactions | Not Available | ||||||||||||||||||
| Targets |
|---|
|
Pharmacological action: yes
Actions: agonist This receptor binds insulin and has a tyrosine-protein kinase activity. Isoform Short has a higher affinity for insulin. Mediates the metabolic functions of insulin. Binding to insulin stimulates association of the receptor with downstream mediators including IRS1 and phosphatidylinositol 3'-kinase (PI3K). Can activate PI3K either directly by binding to the p85 regulatory subunit, or indirectly via IRS1 Organism class: humanUniProt ID: P06213 ![]() Gene: INSR ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References:
2. Insulin-like growth factor 1 receptor Pharmacological action: unknownActions: agonist This receptor binds insulin-like growth factor 1 (IGF1) with a high affinity and IGF2 with a lower affinity. It has a tyrosine-protein kinase activity, which is necessary for the activation of the IGF1-stimulated downstream signaling cascade Organism class: humanUniProt ID: P08069 ![]() Gene: IGF1R ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References:
|
| Enzymes |
|---|
|
Actions: inducer
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Most active in catalyzing 2-hydroxylation. Caffeine is metabolized primarily by cytochrome CYP1A2 in the liver through an initial N3-demethylation. Also acts in the metabolism of aflatoxin B1 and acetaminophen UniProt ID: P05177![]() Gene: CYP1A2 Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References:
|
| Transporters |
|---|
|
Searched, but no transporters found.
|
| Carriers |
|---|
|
Searched, but no carriers found.
|
| Comments |
|---|
This project is supported by Genome Alberta & Genome Canada, a not-for-profit organization that is leading Canada's national genomics strategy with $600 million in funding from the federal government. This project is also supported in part by GenomeQuest, Inc., an enterprise genomic information company serving the life science community.