Banner
Identification
Name Teriparatide
Accession Number DB06285
Type biotech
Groups approved
Description

Teriparatide (recombinant human parathyroid hormone) is a potent anabolic agent used in the treatment of osteoporosis. It is manufactured and marketed by Eli Lilly and Company.
Protein structure
Protein chemical formula C181H291N55O51S2
Protein average weight 4117.7150
Sequences 
>Parathyroid hormone precursor - Homo sapiens (1-34)
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

FASTA
Synonyms
  • hPTH 1-34
  • PTH1-34 nasal spray
  • synthetic human parathyroid hormone 1-34
  • ViaDerm hPTH 1-34
  • ViaDerm-hPTH (1-34)
Brand names
  • Apthela
  • Forsteo
  • Forteo (Eli Lilly and Company)
  • Fortessa
  • Opthia
  • Optia
  • Optiah
  • Zalectra
  • Zelletra
Brand name mixtures Not Available
Categories
  • Bone Density Conservation Agents
CAS number 52232-67-4
Taxonomy
Kingdom Not Available
Classes Not Available
Substructures Not Available
Pharmacology
Indication For the treatment of osteoporosis in men and postmenopausal women who are at high risk for having a fracture. Also used to increase bone mass in men with primary or hypogonadal osteoporosis who are at high risk for fracture.
Pharmacodynamics Clinical trials indicate that teriparatide increases predominantly trabecular bone in the lumbar spine and femoral neck; it has less significant effects at cortical sites. The combination of teriparatide with antiresorptive agents is not more effective than teriparatide monotherapy. The most common adverse effects associated with teriparatide include injection-site pain, nausea, headaches, leg cramps, and dizziness. After a maximum of two years of teriparatide therapy, the drug should be discontinued and antiresorptive therapy begun to maintain bone mineral density.
Mechanism of action Teriparatide is the portion of human parathyroid hormone (PTH),amino acid sequence 1 through 34 of the complete molecule which contains amino acid sequence 1 to 84. Endogenous PTH is the primary regulator of calcium and phosphate metabolism in bone and kidney. Daily injections of teriparatide stimulate new bone formation leading to increased bone mineral density.
Absorption Bioavailability is 95% following subcutaneous injection.
Volume of distribution
  • 0.12 L/kg
Protein binding Not Available
Metabolism

Hepatic
Route of elimination Peripheral metabolism of PTH is believed to occur by non-specific enzymatic mechanisms in the liver followed by excretion via the kidneys. The 24-hour urine excretion of calcium was reduced by a clinically unimportant amount (15%).
Half life Not Available
Clearance
  • 62 L/hr [Women]
  • 94 L/hr [Men]
Toxicity Effects of overexposure may include headaches, dizziness, dizziness, decreased blood pressured, decreased fetal survival, leg cramps, changes in clinical chemistry including increased in blood levels of calcium, decreased serum phosphorous, and increased urinary calcium and phosphorus.
Affected organisms
  • Humans and other mammals
Pathways Not Available
Pharmacoeconomics
Manufacturers
  • Sanofi aventis us llc
  • Eli lilly and co
Packagers
Dosage forms
Form Route Strength
Solution Subcutaneous
Prices
Unit description Cost Unit
Forteo 750 mcg/3 ml pen 295.26 USD ml
Patents
Country Patent Number Approved Expires
United States 6977077 1999-08-19 2019-08-19
United States 6770623 1998-12-08 2018-12-08
Canada 2314313 2005-02-08 2018-12-08
Canada 2325371 2004-08-17 2019-08-19
Properties
State liquid
Melting point Not Available
Experimental Properties Not Available
References
Synthesis Reference Not Available
General Reference
  1. Stroup J, Kane MP, Abu-Baker AM: Teriparatide in the treatment of osteoporosis. Am J Health Syst Pharm. 2008 Mar 15;65(6):532-9. Pubmed
  2. Close P, Neuprez A, Reginster JY: Developments in the pharmacotherapeutic management of osteoporosis. Expert Opin Pharmacother. 2006 Aug;7(12):1603-15. Pubmed
External Links
Resource Link
PharmGKB PA451620 Link_out
Drug Product Database 0 Link_out
Drugs.com http://www.drugs.com/cdi/teriparatide.html Link_out
Wikipedia http://en.wikipedia.org/wiki/Teriparatide Link_out
ATC Codes Not Available
AHFS Codes Not Available
PDB Entries Not Available
FDA label Not Available
MSDS show (24.4 KB)
Interactions
Drug Interactions
Drug Interaction
Food Interactions Not Available
Targets

1. Parathyroid hormone/parathyroid hormone-related peptide receptor

Pharmacological action: unknown
Actions: binder

This is a receptor for parathyroid hormone and for parathyroid hormone-related peptide. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system

Organism class: human
UniProt ID: Q03431 Link_out
Gene: PTH1R
Protein Sequence: FASTA
SNPs: SNPJam Report Link_out

References:
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. Pubmed
Comments
Drug created on March 19, 2008 10:21 / Updated on September 29, 2010 14:35

This project is supported by Genome Alberta & Genome Canada, a not-for-profit organization that is leading Canada's national genomics strategy with $600 million in funding from the federal government. This project is also supported in part by GenomeQuest, Inc., an enterprise genomic information company serving the life science community.