You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameLiraglutide
Accession NumberDB06655
TypeBiotech
GroupsApproved
DescriptionVictoza contains liraglutide, an analog of human GLP-1 and acts as a GLP-1 receptor agonist. The peptide precursor of liraglutide, produced by a process that includes expression of recombinant DNA in Saccharomyces cerevisiae, has been engineered to be 97% homologous to native human GLP-1 by substituting arginine for lysine at position 34. Liraglutide is made by attaching a C-16 fatty acid (palmitic acid) with a glutamic acid spacer on the remaining lysine residue at position 26 of the peptide precursor.
Protein structureNo structure small
Related Articles
Protein chemical formulaC172H265N43O51
Protein average weight3751.2 Da
Sequences
>results for sequence "results for sequence "victoza"" starting "HisAlaGluGly"
HAEGTFTSDVSSYLEGQAAKEEFIIAWLVKGRG
Download FASTA Format
Synonyms
Arg34Lys26-(N-ε-(γ-Glu(N-α-hexadecanoyl)))-GLP-1[7-37]
Liraglutida
Liraglutide recombinant
Liraglutidum
N²⁶-(hexadecanoyl-gamma-glutamyle)-[34-arginine]GLP-1-(7-37)-peptide
N²⁶-(N-Hexadecanoyl-L-gamma-glutamyl)-[34-L-arginine]glucagon-like peptide 1-(7-37)-peptide
NN 2211
NN-2211
NN2211
NNC 90-1170
Victoza
External Identifiers
  • NN 2211
  • UNII-839I73S42A
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Saxendainjection, solution6 mg/mLsubcutaneousNovo Nordisk2014-12-31Not applicableUs
SaxendaSolution for injection6 mg/mlSubcutaneous useNovo Nordisk A/s2015-03-23Not applicableEu
SaxendaSolution for injection6 mg/mlSubcutaneous useNovo Nordisk A/s2015-03-23Not applicableEu
SaxendaSolution for injection6 mg/mlSubcutaneous useNovo Nordisk A/s2015-03-23Not applicableEu
Saxendasolution6 mgsubcutaneousNovo Nordisk Canada Inc2015-05-27Not applicableCanada
VictozaSolution for injection in pre-filled pen6 mg/mlSubcutaneous useNovo Nordisk A/s2009-06-30Not applicableEu
VictozaSolution for injection in pre-filled pen6 mg/mlSubcutaneous useNovo Nordisk A/s2009-06-30Not applicableEu
VictozaSolution for injection in pre-filled pen6 mg/mlSubcutaneous useNovo Nordisk A/s2009-06-30Not applicableEu
Victozainjection, solution6 mg/mLsubcutaneousNovo Nordisk2010-01-25Not applicableUs
VictozaSolution for injection in pre-filled pen6 mg/mlSubcutaneous useNovo Nordisk A/s2009-06-30Not applicableEu
Victozasolution6 mgsubcutaneousNovo Nordisk Canada Inc2010-05-27Not applicableCanada
VictozaSolution for injection in pre-filled pen6 mg/mlSubcutaneous useNovo Nordisk A/s2009-06-30Not applicableEu
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNII839I73S42A
CAS number204656-20-2
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationFor use in/treatment of diabetes mellitus type 2.
PharmacodynamicsLiraglutide is a once-daily GLP-1 derivative for the treatment of type 2 diabetes. GLP-1, in its natural form, is short-lived in the body (the half-life after subcutaneous injection is approximately one hour), so it is not very useful as a therapeutic agent. However, liraglutide has a half-life after subcutaneous injection of 11–15 hours, making it suitable for once-daily dosing. The prolonged action of liraglutide is achieved by attaching a fatty acid molecule at one position of the GLP-1 molecule, enabling it to bind to albumin within the subcutaneous tissue and bloodstream. The active GLP-1 is then released from albumin at a slow, consistent rate. Binding with albumin also results in slower degradation and reduced elimination of liraglutide from the circulation by the kidneys compared to GLP-1.
Mechanism of actionLiraglutide is an acylated GLP-1 (Glucagon-Like Peptide-1) receptor agonist. Liraglutide upregulates intracellular cAMP resulting in the release of insulin given elevated blood glucose concentrations. Glucagon secretion is also decreased in a glucose-dependent fashion by liraglutide.
Related Articles
AbsorptionMaximum concentrations of liraglutide are achieved at 8-12 hours after dose. The mean peak and total exposures of liraglutide were 35 ng/mL and 960 ng·h/mL, respectively, for a subQ single dose of 0.6 mg. After subcutaneous single dose administrations, Cmax and AUC of liraglutide increased proportionally over the therapeutic dose range of 0.6 mg to 1.8 mg. At 1.8 mg Victoza, the average steady state concentration of liraglutide over 24 hours was approximately 128 ng/mL. AUC0-∞ was equivalent between upper arm and abdomen, and between upper arm and thigh. AUC0-∞ from thigh was 22% lower than that from abdomen. Absolute bioavailability of liraglutide following subcutaneous administration is approximately 55%.
Volume of distribution

SubQ 0.6 mg is approximately 13L
Intravenous is approximately 0.07L/kg

Protein binding>98%
Metabolism

During the initial 24 hours following administration of a single [3H]-liraglutide dose to healthy subjects, the major component in plasma was intact liraglutide. Liraglutide is endogenously metabolized in a similar manner to large proteins without a specific organ as a major route of elimination.

Route of eliminationExcreted in urine and feces, 6% and 5%, respectively.
Half lifeapproximately 13 hours.
Clearance

The mean apparent clearance following subcutaneous administration of a single dose of liraglutide is approximately 1.2 L/h

ToxicityIn a clinical trial, one patient with type 2 diabetes experienced a single overdose of Victoza 17.4 mg subcutaneous (10 times the maximum recommended dose). Effects of the overdose included severe nausea and vomiting requiring hospitalization. No hypoglycemia was reported. The patient recovered without complications. In the event of overdosage, appropriate supportive treatment should be initiated according to the patient’s clinical signs and symptoms. RISK OF THYROID C-CELL TUMORS
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
ManufacturersNot Available
PackagersNot Available
Dosage forms
FormRouteStrength
Injection, solutionsubcutaneous6 mg/mL
Solution for injectionSubcutaneous use6 mg/ml
Solutionsubcutaneous6 mg
Solution for injection in pre-filled penSubcutaneous use6 mg/ml
PricesNot Available
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2264243 No2004-10-052017-08-22Canada
US6004297 No1999-01-282019-01-28Us
US6268343 No2002-08-222022-08-22Us
US6458924 No1997-08-222017-08-22Us
US6899699 No2002-01-012022-01-01Us
US7235627 No1997-08-222017-08-22Us
US7686786 No2006-08-032026-08-03Us
US8114833 No2005-08-132025-08-13Us
US8672898 No2002-01-022022-01-02Us
US8684969 No2005-10-202025-10-20Us
US8846618 No2002-06-272022-06-27Us
US8920383 No2006-07-172026-07-17Us
US9108002 No2006-01-262026-01-26Us
US9132239 No2012-02-012032-02-01Us
US9265893 No2012-09-232032-09-23Us
USRE41956 No2001-01-212021-01-21Us
USRE43834 No1999-01-282019-01-28Us
Properties
StateLiquid
Experimental PropertiesNot Available
References
Synthesis ReferenceNot Available
General References
  1. Russell-Jones D: Molecular, pharmacological and clinical aspects of liraglutide, a once-daily human GLP-1 analogue. Mol Cell Endocrinol. 2009 Jan 15;297(1-2):137-40. doi: 10.1016/j.mce.2008.11.018. Epub 2008 Nov 25. [PubMed:19041364 ]
  2. Vilsboll T: Liraglutide: a new treatment for type 2 diabetes. Drugs Today (Barc). 2009 Feb;45(2):101-13. doi: 10.1358/dot.2009.45.2.1336104. [PubMed:19343230 ]
  3. Malm-Erjefalt M, Bjornsdottir I, Vanggaard J, Helleberg H, Larsen U, Oosterhuis B, van Lier JJ, Zdravkovic M, Olsen AK: Metabolism and excretion of the once-daily human glucagon-like peptide-1 analog liraglutide in healthy male subjects and its in vitro degradation by dipeptidyl peptidase IV and neutral endopeptidase. Drug Metab Dispos. 2010 Nov;38(11):1944-53. doi: 10.1124/dmd.110.034066. Epub 2010 Aug 13. [PubMed:20709939 ]
  4. Link [Link]
External Links
ATC CodesA10BX07A10AE56
AHFS CodesNot Available
PDB EntriesNot Available
FDA labelDownload (273 KB)
MSDSDownload (569 KB)
Interactions
Drug Interactions
Drug
7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE may increase the hypoglycemic activities of Liraglutide.
AcetohexamideLiraglutide may increase the hypoglycemic activities of Acetohexamide.
Acetylsalicylic acidAcetylsalicylic acid may increase the hypoglycemic activities of Liraglutide.
Aminosalicylic AcidAminosalicylic Acid may increase the hypoglycemic activities of Liraglutide.
AmoxapineAmoxapine may increase the hypoglycemic activities of Liraglutide.
AripiprazoleThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Aripiprazole.
Arsenic trioxideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Arsenic trioxide.
ArticaineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Articaine.
AsenapineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Asenapine.
AtazanavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Atazanavir.
BendroflumethiazideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Bendroflumethiazide.
BenmoxinBenmoxin may increase the hypoglycemic activities of Liraglutide.
BetamethasoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Betamethasone.
BrexpiprazoleThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Brexpiprazole.
BumetanideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Bumetanide.
BuserelinThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Buserelin.
CaroxazoneCaroxazone may increase the hypoglycemic activities of Liraglutide.
CeritinibThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Ceritinib.
ChlorothiazideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Chlorothiazide.
ChlorpropamideLiraglutide may increase the hypoglycemic activities of Chlorpropamide.
ChlorthalidoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Chlorthalidone.
CitalopramCitalopram may increase the hypoglycemic activities of Liraglutide.
ClomipramineClomipramine may increase the hypoglycemic activities of Liraglutide.
ClozapineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Clozapine.
CorticotropinThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Corticotropin.
Cortisone acetateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Cortisone acetate.
Cyproterone acetateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Cyproterone acetate.
DabrafenibThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Dabrafenib.
DanazolThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Danazol.
DapoxetineDapoxetine may increase the hypoglycemic activities of Liraglutide.
DarunavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Darunavir.
DesogestrelThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Desogestrel.
DexamethasoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Dexamethasone.
DiazoxideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Diazoxide.
DienogestThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Dienogest.
DiflunisalDiflunisal may increase the hypoglycemic activities of Liraglutide.
DihydrotestosteroneDihydrotestosterone may increase the hypoglycemic activities of Liraglutide.
DisopyramideLiraglutide may increase the hypoglycemic activities of Disopyramide.
DrospirenoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Drospirenone.
EpinephrineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Epinephrine.
EscitalopramEscitalopram may increase the hypoglycemic activities of Liraglutide.
EstradiolThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Estradiol.
Estrone sulfateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Estrone sulfate.
Etacrynic acidThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Etacrynic acid.
Ethinyl EstradiolThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Ethinyl Estradiol.
Ethynodiol diacetateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Ethynodiol diacetate.
EtonogestrelThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Etonogestrel.
EtoperidoneEtoperidone may increase the hypoglycemic activities of Liraglutide.
EverolimusThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Everolimus.
FenfluramineFenfluramine may increase the hypoglycemic activities of Liraglutide.
FludrocortisoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Fludrocortisone.
FluoxetineFluoxetine may increase the hypoglycemic activities of Liraglutide.
FluoxymesteroneFluoxymesterone may increase the hypoglycemic activities of Liraglutide.
FluvoxamineFluvoxamine may increase the hypoglycemic activities of Liraglutide.
FosamprenavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Fosamprenavir.
FurazolidoneFurazolidone may increase the hypoglycemic activities of Liraglutide.
FurosemideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Furosemide.
GlibornurideLiraglutide may increase the hypoglycemic activities of Glibornuride.
GliclazideLiraglutide may increase the hypoglycemic activities of Gliclazide.
GlimepirideLiraglutide may increase the hypoglycemic activities of Glimepiride.
GlipizideLiraglutide may increase the hypoglycemic activities of Glipizide.
GliquidoneLiraglutide may increase the hypoglycemic activities of Gliquidone.
GlisoxepideLiraglutide may increase the hypoglycemic activities of Glisoxepide.
GlyburideLiraglutide may increase the hypoglycemic activities of Glyburide.
GoserelinThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Goserelin.
HistrelinThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Histrelin.
HydracarbazineHydracarbazine may increase the hypoglycemic activities of Liraglutide.
HydrochlorothiazideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Hydrochlorothiazide.
HydrocortisoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Hydrocortisone.
HydroflumethiazideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Hydroflumethiazide.
Hydroxyprogesterone caproateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Hydroxyprogesterone caproate.
IloperidoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Iloperidone.
IndalpineIndalpine may increase the hypoglycemic activities of Liraglutide.
IndapamideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Indapamide.
IndinavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Indinavir.
Insulin AspartLiraglutide may increase the hypoglycemic activities of Insulin Aspart.
Insulin DetemirLiraglutide may increase the hypoglycemic activities of Insulin Detemir.
Insulin GlargineLiraglutide may increase the hypoglycemic activities of Insulin Glargine.
Insulin GlulisineLiraglutide may increase the hypoglycemic activities of Insulin Glulisine.
Insulin HumanLiraglutide may increase the hypoglycemic activities of Insulin Human.
Insulin LisproLiraglutide may increase the hypoglycemic activities of Insulin Lispro.
Insulin PorkLiraglutide may increase the hypoglycemic activities of Insulin Pork.
IproclozideIproclozide may increase the hypoglycemic activities of Liraglutide.
IproniazidIproniazid may increase the hypoglycemic activities of Liraglutide.
IsocarboxazidIsocarboxazid may increase the hypoglycemic activities of Liraglutide.
LanreotideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Lanreotide.
LanreotideLiraglutide may increase the hypoglycemic activities of Lanreotide.
LeuprolideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Leuprolide.
LevomilnacipranLevomilnacipran may increase the hypoglycemic activities of Liraglutide.
LevonorgestrelThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Levonorgestrel.
Lipoic AcidLipoic Acid may increase the hypoglycemic activities of Liraglutide.
LopinavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Lopinavir.
Lu AA21004Lu AA21004 may increase the hypoglycemic activities of Liraglutide.
LurasidoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Lurasidone.
MebanazineMebanazine may increase the hypoglycemic activities of Liraglutide.
MecaserminLiraglutide may increase the hypoglycemic activities of Mecasermin.
Medroxyprogesterone acetateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Medroxyprogesterone acetate.
Megestrol acetateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Megestrol acetate.
MesalazineMesalazine may increase the hypoglycemic activities of Liraglutide.
MestranolThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Mestranol.
MethotrimeprazineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Methotrimeprazine.
MethyclothiazideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Methyclothiazide.
Methylene blueMethylene blue may increase the hypoglycemic activities of Liraglutide.
MethylprednisoloneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Methylprednisolone.
MethyltestosteroneMethyltestosterone may increase the hypoglycemic activities of Liraglutide.
MetolazoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Metolazone.
MifepristoneLiraglutide may increase the hypoglycemic activities of Mifepristone.
MilnacipranMilnacipran may increase the hypoglycemic activities of Liraglutide.
MinaprineMinaprine may increase the hypoglycemic activities of Liraglutide.
MoclobemideMoclobemide may increase the hypoglycemic activities of Liraglutide.
NateglinideLiraglutide may increase the hypoglycemic activities of Nateglinide.
NelfinavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Nelfinavir.
NiacinThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Niacin.
NialamideNialamide may increase the hypoglycemic activities of Liraglutide.
NilotinibThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Nilotinib.
NorethisteroneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Norethisterone.
NorgestimateThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Norgestimate.
OctamoxinOctamoxin may increase the hypoglycemic activities of Liraglutide.
OctreotideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Octreotide.
OctreotideLiraglutide may increase the hypoglycemic activities of Octreotide.
OlanzapineOlanzapine may increase the hypoglycemic activities of Liraglutide.
OxandroloneOxandrolone may increase the hypoglycemic activities of Liraglutide.
OxymetholoneOxymetholone may increase the hypoglycemic activities of Liraglutide.
PaliperidoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Paliperidone.
PargylinePargyline may increase the hypoglycemic activities of Liraglutide.
ParoxetineParoxetine may increase the hypoglycemic activities of Liraglutide.
PasireotideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Pasireotide.
PasireotideLiraglutide may increase the hypoglycemic activities of Pasireotide.
PegvisomantPegvisomant may increase the hypoglycemic activities of Liraglutide.
PentamidineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Pentamidine.
PentamidineLiraglutide may increase the hypoglycemic activities of Pentamidine.
PhenelzinePhenelzine may increase the hypoglycemic activities of Liraglutide.
PheniprazinePheniprazine may increase the hypoglycemic activities of Liraglutide.
PhenoxypropazinePhenoxypropazine may increase the hypoglycemic activities of Liraglutide.
PiperazineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Piperazine.
PipotiazineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Pipotiazine.
PirlindolePirlindole may increase the hypoglycemic activities of Liraglutide.
PivhydrazinePivhydrazine may increase the hypoglycemic activities of Liraglutide.
PolythiazideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Polythiazide.
PrednisoloneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Prednisolone.
PrednisoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Prednisone.
ProgesteroneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Progesterone.
QuetiapineThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Quetiapine.
QuinethazoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Quinethazone.
QuinineLiraglutide may increase the hypoglycemic activities of Quinine.
RasagilineRasagiline may increase the hypoglycemic activities of Liraglutide.
RepaglinideLiraglutide may increase the hypoglycemic activities of Repaglinide.
RisperidoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Risperidone.
RitonavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Ritonavir.
SafrazineSafrazine may increase the hypoglycemic activities of Liraglutide.
Salicylic acidSalicylic acid may increase the hypoglycemic activities of Liraglutide.
SaquinavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Saquinavir.
SelegilineSelegiline may increase the hypoglycemic activities of Liraglutide.
SertralineSertraline may increase the hypoglycemic activities of Liraglutide.
SirolimusThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Sirolimus.
StanozololStanozolol may increase the hypoglycemic activities of Liraglutide.
SulfadiazineLiraglutide may increase the hypoglycemic activities of Sulfadiazine.
SulfamethoxazoleLiraglutide may increase the hypoglycemic activities of Sulfamethoxazole.
SulfisoxazoleLiraglutide may increase the hypoglycemic activities of Sulfisoxazole.
SunitinibLiraglutide may increase the hypoglycemic activities of Sunitinib.
TacrolimusThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Tacrolimus.
TemsirolimusThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Temsirolimus.
TestosteroneTestosterone may increase the hypoglycemic activities of Liraglutide.
TipranavirThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Tipranavir.
TolazamideLiraglutide may increase the hypoglycemic activities of Tolazamide.
TolbutamideLiraglutide may increase the hypoglycemic activities of Tolbutamide.
ToloxatoneToloxatone may increase the hypoglycemic activities of Liraglutide.
TorasemideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Torasemide.
Trans-2-PhenylcyclopropylamineTrans-2-Phenylcyclopropylamine may increase the hypoglycemic activities of Liraglutide.
TranylcypromineTranylcypromine may increase the hypoglycemic activities of Liraglutide.
TrazodoneTrazodone may increase the hypoglycemic activities of Liraglutide.
TriamcinoloneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Triamcinolone.
TrichlormethiazideThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Trichlormethiazide.
TriptorelinThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Triptorelin.
VilazodoneVilazodone may increase the hypoglycemic activities of Liraglutide.
VorinostatThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Vorinostat.
VortioxetineVortioxetine may increase the hypoglycemic activities of Liraglutide.
ZimelidineZimelidine may increase the hypoglycemic activities of Liraglutide.
ZiprasidoneThe therapeutic efficacy of Liraglutide can be decreased when used in combination with Ziprasidone.
Food InteractionsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Transmembrane signaling receptor activity
Specific Function:
This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene Name:
GLP1R
Uniprot ID:
P43220
Molecular Weight:
53025.22 Da
References
  1. Bock T, Pakkenberg B, Buschard K: The endocrine pancreas in non-diabetic rats after short-term and long-term treatment with the long-acting GLP-1 derivative NN2211. APMIS. 2003 Dec;111(12):1117-24. [PubMed:14678021 ]
  2. Larsen PJ, Wulff EM, Gotfredsen CF, Brand CL, Sturis J, Vrang N, Knudsen LB, Lykkegaard K: Combination of the insulin sensitizer, pioglitazone, and the long-acting GLP-1 human analog, liraglutide, exerts potent synergistic glucose-lowering efficacy in severely diabetic ZDF rats. Diabetes Obes Metab. 2008 Apr;10(4):301-11. doi: 10.1111/j.1463-1326.2008.00865.x. [PubMed:18333889 ]

Enzymes

Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
substrate
General Function:
Virus receptor activity
Specific Function:
Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Acts as a positive regulator of T-cell coactivation, by binding at least ADA, CAV1, IGF2R, and PTPRC. Its binding to CAV1 and CARD11 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Its interaction with ADA also ...
Gene Name:
DPP4
Uniprot ID:
P27487
Molecular Weight:
88277.935 Da
References
  1. Malm-Erjefalt M, Bjornsdottir I, Vanggaard J, Helleberg H, Larsen U, Oosterhuis B, van Lier JJ, Zdravkovic M, Olsen AK: Metabolism and excretion of the once-daily human glucagon-like peptide-1 analog liraglutide in healthy male subjects and its in vitro degradation by dipeptidyl peptidase IV and neutral endopeptidase. Drug Metab Dispos. 2010 Nov;38(11):1944-53. doi: 10.1124/dmd.110.034066. Epub 2010 Aug 13. [PubMed:20709939 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
substrate
General Function:
Zinc ion binding
Specific Function:
Thermolysin-like specificity, but is almost confined on acting on polypeptides of up to 30 amino acids (PubMed:15283675, PubMed:8168535). Biologically important in the destruction of opioid peptides such as Met- and Leu-enkephalins by cleavage of a Gly-Phe bond (PubMed:17101991). Able to cleave angiotensin-1, angiotensin-2 and angiotensin 1-9 (PubMed:15283675). Involved in the degradation of at...
Gene Name:
MME
Uniprot ID:
P08473
Molecular Weight:
85513.225 Da
References
  1. Malm-Erjefalt M, Bjornsdottir I, Vanggaard J, Helleberg H, Larsen U, Oosterhuis B, van Lier JJ, Zdravkovic M, Olsen AK: Metabolism and excretion of the once-daily human glucagon-like peptide-1 analog liraglutide in healthy male subjects and its in vitro degradation by dipeptidyl peptidase IV and neutral endopeptidase. Drug Metab Dispos. 2010 Nov;38(11):1944-53. doi: 10.1124/dmd.110.034066. Epub 2010 Aug 13. [PubMed:20709939 ]
Comments
comments powered by Disqus
Drug created on March 19, 2008 10:45 / Updated on September 25, 2016 02:24