Endolysin
Details
- Name
- Endolysin
- Synonyms
- 3.2.1.17
- Lysis protein
- Lysozyme
- Muramidase
- Gene Name
- E
- Organism
- Enterobacteria phage T4
- Amino acid sequence
>lcl|BSEQ0016364|Endolysin MNIFEMLRIDERLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITK DEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRM LQQKRWDEAAVNLAKSIWYNQTPNRAKRVITTFRTGTWDAYKNL
- Number of residues
- 164
- Molecular Weight
- 18691.385
- Theoretical pI
- 10.08
- GO Classification
- Functionslysozyme activityProcessescell wall macromolecule catabolic process / cytolysis / defense response to bacterium / peptidoglycan catabolic process / viral release from host cellComponentshost cell cytoplasm
- General Function
- Lysozyme activity
- Specific Function
- Endolysin with lysozyme activity that degrades host peptidoglycans and participates with the holin and spanin proteins in the sequential events which lead to the programmed host cell lysis releasing the mature viral particles. Once the holin has permeabilized the host cell membrane, the endolysin can reach the periplasm and break down the peptidoglycan layer.
- Pfam Domain Function
- Phage_lysozyme (PF00959)
- Transmembrane Regions
- Not Available
- Cellular Location
- Host cytoplasm
- Gene sequence
>lcl|BSEQ0016365|Endolysin (E) ATGAATATATTTGAAATGTTACGTATAGATGAACGTCTTAGACTTAAAATCTATAAAGAC ACAGAAGGCTATTACACTATTGGCATCGGTCATTTGCTTACAAAAAGTCCATCACTTAAT GCTGCTAAATCTGAATTAGATAAAGCTATTGGGCGTAATTGCAATGGTGTAATTACAAAA GATGAGGCTGAAAAACTCTTTAATCAGGATGTTGATGCTGCTGTTCGCGGAATTCTGAGA AATGCTAAATTAAAACCGGTTTATGATTCTCTTGATGCGGTTCGTCGCTGTGCATTGATT AATATGGTTTTCCAAATGGGAGAAACCGGTGTGGCAGGATTTACTAACTCTTTACGTATG CTTCAACAAAAACGCTGGGATGAAGCAGCAGTTAACTTAGCTAAAAGTATATGGTATAAT CAAACACCTAATCGCGCAAAACGAGTCATTACAACGTTTAGAACTGGCACTTGGGACGCG TATAAAAATCTATAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P00720 UniProtKB Entry Name ENLYS_BPT4 GenBank Protein ID 15261 GenBank Gene ID X04567 - General References
- Inouye M, Imada M, Tsugita A: The amino acid sequence of T4 phage lysozyme. IV. Dilute acid hydrolysis and the order of tryptic peptides. J Biol Chem. 1970 Jul 25;245(14):3479-84. [Article]
- Owen JE, Schultz DW, Taylor A, Smith GR: Nucleotide sequence of the lysozyme gene of bacteriophage T4. Analysis of mutations involving repeated sequences. J Mol Biol. 1983 Apr 5;165(2):229-48. [Article]
- Valerie K, Stevens J, Lynch M, Henderson EE, de Riel JK: Nucleotide sequence and analysis of the 58.3 to 65.5-kb early region of bacteriophage T4. Nucleic Acids Res. 1986 Nov 11;14(21):8637-54. [Article]
- Miller ES, Kutter E, Mosig G, Arisaka F, Kunisawa T, Ruger W: Bacteriophage T4 genome. Microbiol Mol Biol Rev. 2003 Mar;67(1):86-156, table of contents. [Article]
- Moussa SH, Kuznetsov V, Tran TA, Sacchettini JC, Young R: Protein determinants of phage T4 lysis inhibition. Protein Sci. 2012 Apr;21(4):571-82. doi: 10.1002/pro.2042. Epub 2012 Mar 2. [Article]
- Matthews BW, Remington SJ: The three dimensional structure of the lysozyme from bacteriophage T4. Proc Natl Acad Sci U S A. 1974 Oct;71(10):4178-82. [Article]
- Weaver LH, Matthews BW: Structure of bacteriophage T4 lysozyme refined at 1.7 A resolution. J Mol Biol. 1987 Jan 5;193(1):189-99. [Article]
- Remington SJ, Eyck LF, Matthews BW: Atomic coordinates for T4 phage lysozyme. Biochem Biophys Res Commun. 1977 Mar 21;75(2):265-70. [Article]
- Matsumura M, Becktel WJ, Matthews BW: Hydrophobic stabilization in T4 lysozyme determined directly by multiple substitutions of Ile 3. Nature. 1988 Aug 4;334(6181):406-10. [Article]
- Faber HR, Matthews BW: A mutant T4 lysozyme displays five different crystal conformations. Nature. 1990 Nov 15;348(6298):263-6. [Article]
- Eriksson AE, Baase WA, Wozniak JA, Matthews BW: A cavity-containing mutant of T4 lysozyme is stabilized by buried benzene. Nature. 1992 Jan 23;355(6358):371-3. [Article]
- McIntosh LP, Wand AJ, Lowry DF, Redfield AG, Dahlquist FW: Assignment of the backbone 1H and 15N NMR resonances of bacteriophage T4 lysozyme. Biochemistry. 1990 Jul 10;29(27):6341-62. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB01932 5-Methylpyrrole experimental unknown Details DB01957 3-Chlorophenol experimental unknown Details DB01986 3-Fluoro-2-Methyl-Aniline experimental unknown Details DB02210 Hexane-1,6-Diol experimental unknown Details DB02403 2-Fluoroaniline experimental unknown Details DB02486 2-Hydroxyethyl Disulfide experimental unknown Details DB02534 2-Allylphenol experimental unknown Details DB02870 N-Allylaniline experimental unknown Details DB02970 2-Propyl-Aniline experimental unknown Details DB00536 Guanidine approved unknown Details DB03238 3,5-Difluoroaniline experimental unknown Details DB03301 2-Allyl-6-Methyl-Phenol experimental unknown Details DB03345 Mercaptoethanol experimental unknown Details DB03660 4-Iodo-L-phenylalanine experimental unknown Details DB03669 4-Fluorophenethyl Alcohol experimental unknown Details DB03842 2-Chloro-6-Methyl-Aniline experimental unknown Details DB04179 Benzofuran experimental unknown Details DB04532 Indole experimental unknown Details DB06934 (1R)-3-chloro-1-phenylpropan-1-ol experimental unknown Details DB07543 (S)-carazolol experimental unknown Details DB08456 S-[(1-Hydroxy-2,2,5,5-tetramethyl-4-phenyl-2,5-dihydro-1H-pyrrol-3-yl)methyl] methanesulfonothioate experimental unknown Details DB00373 Timolol approved unknown Details