Ig gamma-2 chain C region
Details
- Name
- Ig gamma-2 chain C region
- Synonyms
- Not Available
- Gene Name
- IGHG2
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0017230|Ig gamma-2 chain C region ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFR VVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKN QVSLTCLVKGFYPSDISVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPGK
- Number of residues
- 326
- Molecular Weight
- 35900.445
- Theoretical pI
- 7.66
- GO Classification
- Functionsantigen binding / immunoglobulin receptor bindingProcessesB cell receptor signaling pathway / complement activation / complement activation, classical pathway / defense response to bacterium / Fc-epsilon receptor signaling pathway / Fc-gamma receptor signaling pathway involved in phagocytosis / innate immune response / phagocytosis, engulfment / phagocytosis, recognition / positive regulation of B cell activation / receptor-mediated endocytosisComponentsblood microparticle / external side of plasma membrane / extracellular exosome / extracellular region / extracellular space / immunoglobulin complex, circulating
- General Function
- Immunoglobulin receptor binding
- Specific Function
- Not Available
- Pfam Domain Function
- C1-set (PF07654)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Chromosome Location
- Not Available
- Locus
- 14q32.33
- External Identifiers
Resource Link UniProtKB ID P01859 UniProtKB Entry Name IGHG2_HUMAN GenBank Gene ID AL928742 HGNC ID HGNC:5526 - General References
- Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [Article]
- Ellison J, Hood L: Linkage and sequence homology of two human immunoglobulin gamma heavy chain constant region genes. Proc Natl Acad Sci U S A. 1982 Mar;79(6):1984-8. [Article]
- Takahashi N, Ueda S, Obata M, Nikaido T, Nakai S, Honjo T: Structure of human immunoglobulin gamma genes: implications for evolution of a gene family. Cell. 1982 Jun;29(2):671-9. [Article]
- Krawinkel U, Rabbitts TH: Comparison of the hinge-coding segments in human immunoglobulin gamma heavy chain genes and the linkage of the gamma 2 and gamma 4 subclass genes. EMBO J. 1982;1(4):403-7. [Article]
- Wang AC, Tung E, Fudenberg HH: The primary structure of a human IgG2 heavy chain: genetic, evolutionary, and functional implications. J Immunol. 1980 Sep;125(3):1048-54. [Article]
- Connell GE, Parr DM, Hofmann T: The amino acid sequences of the three heavy chain constant region domains of a human IgG2 myeloma protein. Can J Biochem. 1979 Jun;57(6):758-67. [Article]
- Hofmann T, Parr DM: A note of the amino acid sequence of residues 381--391 of human immunoglobulins gamma chains. Mol Immunol. 1979 Nov;16(11):923-5. [Article]
- Stoppini M, Bellotti V, Negri A, Merlini G, Garver F, Ferri G: Characterization of the two unique human anti-flavin monoclonal immunoglobulins. Eur J Biochem. 1995 Mar 15;228(3):886-93. [Article]
- Milstein C, Frangione B: Disulphide bridges of the heavy chain of human immunoglobulin G2. Biochem J. 1971 Jan;121(2):217-25. [Article]
- Frangione B, Milstein C, Pink JR: Structural studies of immunoglobulin G. Nature. 1969 Jan 11;221(5176):145-8. [Article]
- Kristiansen TZ, Bunkenborg J, Gronborg M, Molina H, Thuluvath PJ, Argani P, Goggins MG, Maitra A, Pandey A: A proteomic analysis of human bile. Mol Cell Proteomics. 2004 Jul;3(7):715-28. Epub 2004 Apr 14. [Article]
- Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [Article]
- Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH: A strategy for precise and large scale identification of core fucosylated glycoproteins. Mol Cell Proteomics. 2009 May;8(5):913-23. doi: 10.1074/mcp.M800504-MCP200. Epub 2009 Jan 12. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB07329 1-[N-4'-NITROBENZYL-N-4'-CARBOXYBUTYLAMINO]METHYLPHOSPHONIC ACID experimental unknown Details DB02854 Aetiocholanolone experimental unknown Details DB07375 Etiocholanedione experimental unknown Details DB04688 Methylecgonine experimental unknown Details DB08323 3-OXO-N-[(3S)-2-OXOPYRROLIDIN-3-YL]DODECANAMIDE experimental unknown Details DB08409 4-NITRO-BENZYLPHOSPHONOBUTANOYL-GLYCINE experimental unknown Details DB08510 5-ALPHA-PREGNANE-3-BETA-OL-HEMISUCCINATE experimental unknown Details DB08547 PROGESTERONE-11-ALPHA-OL-HEMISUCCINATE experimental unknown Details DB08618 3-(HYDROXY-PHENYL-PHOSPHINOYLOXY)-8-METHYL-8-AZA-BICYCLO[3.2.1]OCTANE-2-CARBOXYLIC ACID METHYL ESTER experimental unknown Details DB15258 Imlifidase approved, investigational yes cleavage Details