Proton-coupled amino acid transporter 1

Details

Name
Proton-coupled amino acid transporter 1
Synonyms
  • PAT1
  • Proton/amino acid transporter 1
  • Solute carrier family 36 member 1
Gene Name
SLC36A1
Organism
Human
Amino acid sequence
>lcl|BSEQ0001070|Proton-coupled amino acid transporter 1
MSTQRLRNEDYHDYSSTDVSPEESPSEGLNNLSSPGSYQRFGQSNSTTWFQTLIHLLKGN
IGTGLLGLPLAVKNAGIVMGPISLLIIGIVAVHCMGILVKCAHHFCRRLNKSFVDYGDTV
MYGLESSPCSWLRNHAHWGRRVVDFFLIVTQLGFCCVYFVFLADNFKQVIEAANGTTNNC
HNNETVILTPTMDSRLYMLSFLPFLVLLVFIRNLRALSIFSLLANITMLVSLVMIYQFIV
QRIPDPSHLPLVAPWKTYPLFFGTAIFSFEGIGMVLPLENKMKDPRKFPLILYLGMVIVT
ILYISLGCLGYLQFGANIQGSITLNLPNCWLYQSVKLLYSIGIFFTYALQFYVPAEIIIP
FFVSRAPEHCELVVDLFVRTVLVCLTCILAILIPRLDLVISLVGSVSSSALALIIPPLLE
VTTFYSEGMSPLTIFKDALISILGFVGFVVGTYEALYELIQPSNAPIFINSTCAFI
Number of residues
476
Molecular Weight
53075.045
Theoretical pI
7.0
GO Classification
Functions
hydrogen / hydrogen ion transmembrane transporter activity / L-proline transmembrane transporter activity / glycine transmembrane transporter activity / L-alanine transmembrane transporter activity
Processes
proton transport / ion transport / amino acid transport / proline transmembrane transport / glycine transport / transmembrane transport / hydrogen ion transmembrane transport / L-alanine transport
Components
endoplasmic reticulum / plasma membrane / integral component of membrane / lysosomal membrane
General Function
L-proline transmembrane transporter activity
Specific Function
Neutral amino acid/proton symporter. Has a pH-dependent electrogenic transport activity for small amino acids such as glycine, alanine and proline. Besides small apolar L-amino acids, it also recognize their D-enantiomers and selected amino acid derivatives such as gamma-aminobutyric acid (By similarity).
Pfam Domain Function
Transmembrane Regions
52-72 79-99 142-162 191-211 216-236 258-278 290-310 343-363 373-393 398-418 440-460
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0020464|Proton-coupled amino acid transporter 1 (SLC36A1)
ATGTCCACGCAGAGACTTCGGAATGAAGACTACCACGACTACAGCTCCACGGACGTGAGC
CCTGAGGAGAGCCCGTCGGAAGGCCTCAACAACCTCTCCTCCCCGGGCTCCTACCAGCGC
TTTGGTCAAAGCAATAGCACAACATGGTTCCAGACCTTGATCCACCTGTTAAAAGGCAAC
ATTGGCACAGGACTCCTGGGACTCCCTCTGGCGGTGAAAAATGCAGGCATCGTGATGGGT
CCCATCAGCCTGCTGATCATAGGCATCGTGGCCGTGCACTGCATGGGTATCCTGGTGAAA
TGTGCTCACCACTTCTGCCGCAGGCTGAATAAATCCTTTGTGGATTATGGTGATACTGTG
ATGTATGGACTAGAATCCAGCCCCTGCTCCTGGCTCCGGAACCACGCACACTGGGGAAGA
CGTGTTGTGGACTTCTTCCTGATTGTCACCCAGCTGGGATTCTGCTGTGTCTATTTTGTG
TTTCTGGCTGACAACTTTAAACAGGTGATAGAAGCGGCCAATGGGACCACCAATAACTGC
CACAACAATGAGACGGTGATTCTGACGCCTACCATGGACTCGCGACTCTACATGCTCTCC
TTCCTGCCCTTCCTGGTGCTGCTGGTTTTCATCAGGAACCTCCGAGCCCTGTCCATCTTC
TCCCTGTTGGCCAACATCACCATGCTGGTCAGCTTGGTCATGATCTACCAGTTCATTGTT
CAGAGGATCCCAGACCCCAGCCACCTCCCCTTGGTGGCCCCTTGGAAGACCTACCCTCTC
TTCTTTGGCACAGCGATTTTTTCATTTGAAGGCATTGGAATGGTTCTGCCCCTGGAAAAC
AAAATGAAGGATCCTCGGAAGTTCCCACTCATCCTGTACCTGGGCATGGTCATCGTCACC
ATCCTCTACATCAGCCTGGGGTGTCTGGGGTACCTGCAATTTGGAGCTAATATCCAAGGC
AGCATAACCCTCAACCTGCCCAACTGCTGGTTGTACCAGTCAGTTAAGCTGCTGTACTCC
ATCGGGATCTTTTTCACCTACGCACTCCAGTTCTACGTCCCGGCTGAGATCATCATCCCC
TTCTTTGTGTCCCGAGCGCCCGAGCACTGTGAGTTAGTGGTGGACCTGTTTGTGCGCACA
GTGCTGGTCTGCCTGACATGA
Chromosome Location
5
Locus
5q33.1
External Identifiers
ResourceLink
UniProtKB IDQ7Z2H8
UniProtKB Entry NameS36A1_HUMAN
GenBank Protein ID31324239
GenBank Gene IDAF516142
GenAtlas IDSLC36A1
HGNC IDHGNC:18761
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00160L-Alanineapproved, nutraceuticalunknownDetails
DB00145Glycineapproved, nutraceutical, vet_approvedunknownDetails
DB06554GaboxadolinvestigationalunknownsubstrateDetails
DB00659Acamprosateapproved, investigationalunknownDetails
DB08847Hydroxyprolineapproved, experimentalunknownDetails
DB02853D-ProlineexperimentalunknownDetails
DB01080VigabatrinapprovedunknownDetails
DB02530gamma-Aminobutyric acidapproved, investigationalunknownDetails
DB08835Spaglumic AcidexperimentalunknownsubstrateotherDetails
DB01956Taurineapproved, nutraceuticalnosubstrateDetails