Monocarboxylate transporter 2

Details

Name
Monocarboxylate transporter 2
Synonyms
  • MCT 2
  • MCT2
  • Solute carrier family 16 member 7
Gene Name
SLC16A7
Organism
Humans
Amino acid sequence
>lcl|BSEQ0010306|Monocarboxylate transporter 2
MPPMPSAPPVHPPPDGGWGWIVVGAAFISIGFSYAFPKAVTVFFKEIQQIFHTTYSEIAW
ISSIMLAVMYAGGPVSSVLVNKYGSRPVVIAGGLLCCLGMVLASFSSSVVQLYLTMGFIT
GLGLAFNLQPALTIIGKYFYRKRPMANGLAMAGSPVFLSSLAPFNQYLFNTFGWKGSFLI
LGSLLLNACVAGSLMRPLGPNQTTSKSKNKTGKTEDDSSPKKIKTKKSTWEKVNKYLDFS
LFKHRGFLIYLSGNVIMFLGFFAPIIFLAPYAKDQGIDEYSAAFLLSVMAFVDMFARPSV
GLIANSKYIRPRIQYFFSFAIMFNGVCHLLCPLAQDYTSLVLYAVFFGLGFGSVSSVLFE
TLMDLVGAPRFSSAVGLVTIVECGPVLLGPPLAGKLVDLTGEYKYMYMSCGAIVVAASVW
LLIGNAINYRLLAKERKEENARQKTRESEPLSKSKHSEDVNVKVSNAQSVTSERETNI
Number of residues
478
Molecular Weight
52199.745
Theoretical pI
9.68
GO Classification
Functions
lactate transmembrane transporter activity / pyruvate secondary active transmembrane transporter activity / pyruvate transmembrane transporter activity / symporter activity
Processes
lactate transmembrane transport / plasma membrane lactate transport / pyruvate transmembrane transport / transmembrane transport
Components
cytoplasm / integral component of plasma membrane / plasma membrane
General Function
Symporter activity
Specific Function
Proton-coupled monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate. Functions as high-affinity pyruvate transporter.
Pfam Domain Function
Transmembrane Regions
16-36 60-80 90-110 116-136 149-169 174-194 247-267 283-303 313-333 339-359 374-394 407-427
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010307|Monocarboxylate transporter 2 (SLC16A7)
ATGCCACCAATGCCAAGTGCCCCACCTGTGCATCCACCTCCAGATGGAGGATGGGGTTGG
ATTGTGGTTGGAGCAGCTTTTATCTCCATTGGATTTTCCTATGCATTCCCCAAAGCTGTC
ACCGTATTCTTCAAAGAAATTCAGCAAATATTCCACACTACCTACAGTGAAATAGCATGG
ATTTCATCCATTATGCTGGCTGTTATGTACGCAGGAGGTCCTGTAAGTAGTGTTTTGGTG
AATAAATACGGCAGCCGGCCGGTGGTGATAGCAGGAGGCTTATTATGCTGTCTTGGAATG
GTGTTGGCCTCCTTTAGTAGCAGCGTGGTACAGCTGTACCTCACTATGGGATTCATTACA
GGTTTAGGTTTAGCCTTCAACCTGCAACCCGCCTTAACCATAATTGGCAAATACTTCTAT
AGGAAGCGACCCATGGCAAATGGATTGGCCATGGCAGGAAGTCCTGTTTTCTTAAGTTCA
TTGGCTCCTTTCAATCAGTACCTTTTTAATACTTTTGGCTGGAAAGGAAGCTTCCTGATT
TTGGGAAGTCTACTTTTGAATGCCTGTGTGGCTGGTTCCCTCATGAGACCCCTTGGACCC
AATCAAACCACTTCTAAGTCTAAAAATAAGACTGGCAAAACAGAAGATGATTCAAGCCCA
AAGAAAATCAAAACGAAGAAATCAACTTGGGAAAAAGTTAATAAGTATTTAGATTTCTCC
CTTTTTAAGCATAGAGGATTTCTGATATATCTGTCTGGAAATGTCATTATGTTCCTAGGT
TTTTTTGCCCCCATTATATTCTTGGCTCCATATGCTAAAGACCAAGGAATTGATGAGTAC
TCGGCAGCTTTTCTGCTATCTGTTATGGCTTTCGTTGATATGTTTGCTAGGCCTTCTGTA
GGATTAATTGCAAACTCCAAATATATTCGACCTCGAATTCAGTACTTCTTCAGTTTTGCA
ATCATGTTCAATGGAGTGTGTCACCTCTTGTGCCCACTGGCACAGGACTACACAAGCCTG
GTATTATATGCTGTATTTTTTGGCCTTGGATTTGGGAGTGTTAGCAGTGTTCTCTTTGAA
ACTCTCATGGACCTCGTGGGTGCACCAAGATTTTCCAGTGCCGTCGGACTTGTCACAATT
GTGGAGTGTGGCCCAGTTCTTCTTGGCCCTCCTCTTGCAGGTAAATTGGTGGATTTAACT
GGAGAATATAAATACATGTACATGTCCTGTGGGGCTATTGTGGTAGCAGCAAGCGTGTGG
CTGCTCATTGGCAATGCTATCAACTATAGATTGCTTGCAAAGGAAAGGAAGGAGGAAAAT
GCAAGGCAGAAGACCAGAGAATCTGAACCCTTGAGCAAATCTAAACATTCGGAAGATGTT
AACGTCAAAGTTTCAAATGCACAGAGTGTAACCTCAGAAAGAGAAACTAACATTTAA
Chromosome Location
12
Locus
12q13
External Identifiers
ResourceLink
UniProtKB IDO60669
UniProtKB Entry NameMOT2_HUMAN
GenBank Protein ID3047402
GenBank Gene IDAF058056
GenAtlas IDSLC16A7
HGNC IDHGNC:10928
General References
  1. Lin RY, Vera JC, Chaganti RS, Golde DW: Human monocarboxylate transporter 2 (MCT2) is a high affinity pyruvate transporter. J Biol Chem. 1998 Oct 30;273(44):28959-65. [PubMed:9786900]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. [PubMed:16541075]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Merezhinskaya N, Ogunwuyi SA, Mullick FG, Fishbein WN: Presence and localization of three lactic acid transporters (MCT1, -2, and -4) in separated human granulocytes, lymphocytes, and monocytes. J Histochem Cytochem. 2004 Nov;52(11):1483-93. [PubMed:15505343]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00119Pyruvic acidapproved, investigational, nutraceuticalunknownDetails
DB03066D-Lactic acidexperimentalunknowninhibitorDetails
DB04398Lactic acidapproved, vet_approvedunknownsubstrateinhibitorDetails
DB03773alpha-D-quinovopyranoseexperimentalunknowninhibitorDetails
DB01440gamma-Hydroxybutyric acidapproved, illicit, investigationalunknowninhibitorDetails
DB04216Quercetinexperimental, investigationalunknowninhibitorDetails
DB01032Probenecidapproved, investigationalunknowninhibitorDetails
DB04552Niflumic acidexperimentalunknowninhibitorDetails
DB01762Acetoacetic AcidexperimentalunknowninhibitorDetails
DB00119Pyruvic acidapproved, investigational, nutraceuticalunknownsubstrateinhibitorDetails
DB04074alpha-KetoisovalerateexperimentalunknowninhibitorDetails