Sodium channel subunit beta-2

Details

Name
Sodium channel subunit beta-2
Synonyms
Not Available
Gene Name
SCN2B
Organism
Humans
Amino acid sequence
>lcl|BSEQ0012528|Sodium channel subunit beta-2
MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNH
KQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPE
DEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVV
KCVRRKKEQKLSTDDLKTEEEGKTDGEGNPDDGAK
Number of residues
215
Molecular Weight
24325.69
Theoretical pI
6.35
GO Classification
Functions
sodium channel regulator activity / voltage-gated sodium channel activity involved in cardiac muscle cell action potential
Processes
cardiac muscle cell action potential involved in contraction / cardiac muscle contraction / membrane depolarization during cardiac muscle cell action potential / nervous system development / regulation of atrial cardiac muscle cell membrane depolarization / regulation of heart rate by cardiac conduction / regulation of sodium ion transmembrane transporter activity / response to pyrethroid / sodium ion transmembrane transport / synaptic transmission
Components
voltage-gated sodium channel complex
General Function
Voltage-gated sodium channel activity involved in cardiac muscle cell action potential
Specific Function
Crucial in the assembly, expression, and functional modulation of the heterotrimeric complex of the sodium channel. The subunit beta-2 causes an increase in the plasma membrane surface area and in its folding into microvilli. Interacts with TNR may play a crucial role in clustering and regulation of activity of sodium channels at nodes of Ranvier (By similarity).
Pfam Domain Function
Transmembrane Regions
160-180
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0012529|Sodium channel subunit beta-2 (SCN2B)
ATGCACAGAGATGCCTGGCTACCTCGCCCTGCCTTCAGCCTCACGGGGCTCAGTCTCTTT
TTCTCTTTGGTGCCACCAGGACGGAGCATGGAGGTCACAGTACCTGCCACCCTCAACGTC
CTCAATGGCTCTGACGCCCGCCTGCCCTGCACCTTCAACTCCTGCTACACAGTGAACCAC
AAACAGTTCTCCCTGAACTGGACTTACCAGGAGTGCAACAACTGCTCTGAGGAGATGTTC
CTCCAGTTCCGCATGAAGATCATTAACCTGAAGCTGGAGCGGTTTCAAGACCGCGTGGAG
TTCTCAGGGAACCCCAGCAAGTACGATGTGTCGGTGATGCTGAGAAACGTGCAGCCGGAG
GATGAGGGGATTTACAACTGCTACATCATGAACCCCCCTGACCGCCACCGTGGCCATGGC
AAGATCCATCTGCAGGTCCTCATGGAAGAGCCCCCTGAGCGGGACTCCACGGTGGCCGTG
ATTGTGGGTGCCTCCGTCGGGGGCTTCCTGGCTGTGGTCATCTTGGTGCTGATGGTGGTC
AAGTGTGTGAGGAGAAAAAAAGAGCAGAAGCTGAGCACAGATGACCTGAAGACCGAGGAG
GAGGGCAAGACGGACGGTGAAGGCAACCCGGATGATGGCGCCAAGTAG
Chromosome Location
11
Locus
11q23
External Identifiers
ResourceLink
UniProtKB IDO60939
UniProtKB Entry NameSCN2B_HUMAN
GenBank Protein ID3309111
GenBank Gene IDAF007783
HGNC IDHGNC:10589
General References
  1. Eubanks J, Srinivasan J, Dinulos MB, Disteche CM, Catterall WA: Structure and chromosomal localization of the beta2 subunit of the human brain sodium channel. Neuroreport. 1997 Aug 18;8(12):2775-9. [PubMed:9295116]
  2. Bolino A, Seri M, Caroli F, Eubanks J, Srinivasan J, Mandich P, Schenone A, Quattrone A, Romeo G, Catterall WA, Devoto M: Exclusion of the SCN2B gene as candidate for CMT4B. Eur J Hum Genet. 1998 Nov-Dec;6(6):629-34. [PubMed:9887383]
  3. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [PubMed:12975309]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Chen C, Calhoun JD, Zhang Y, Lopez-Santiago L, Zhou N, Davis TH, Salzer JL, Isom LL: Identification of the cysteine residue responsible for disulfide linkage of Na+ channel alpha and beta2 subunits. J Biol Chem. 2012 Nov 9;287(46):39061-9. doi: 10.1074/jbc.M112.397646. Epub 2012 Sep 19. [PubMed:22992729]
  6. Watanabe H, Darbar D, Kaiser DW, Jiramongkolchai K, Chopra S, Donahue BS, Kannankeril PJ, Roden DM: Mutations in sodium channel beta1- and beta2-subunits associated with atrial fibrillation. Circ Arrhythm Electrophysiol. 2009 Jun;2(3):268-75. doi: 10.1161/CIRCEP.108.779181. Epub 2009 Mar 6. [PubMed:19808477]
  7. Riuro H, Beltran-Alvarez P, Tarradas A, Selga E, Campuzano O, Verges M, Pagans S, Iglesias A, Brugada J, Brugada P, Vazquez FM, Perez GJ, Scornik FS, Brugada R: A missense mutation in the sodium channel beta2 subunit reveals SCN2B as a new candidate gene for Brugada syndrome. Hum Mutat. 2013 Jul;34(7):961-6. doi: 10.1002/humu.22328. Epub 2013 Apr 29. [PubMed:23559163]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00909Zonisamideapproved, investigationalyesinhibitorDetails
DB00313Valproic acidapproved, investigationalunknowninhibitorDetails
DB05541Brivaracetamapproved, investigationalyesinhibitorDetails
DB13961Fish oilapproved, nutraceuticalunknowninhibitorDetails
DB13269Dichlorobenzyl alcoholapprovedyesantagonistDetails
DB00243Ranolazineapproved, investigationalunknowninhibitorDetails
DB00776OxcarbazepineapprovedunknowninhibitorDetails