Penicillin-binding protein 1A

Details

Name
Penicillin-binding protein 1A
Synonyms
  • exp2
  • Exported protein 2
  • PBP-1A
Gene Name
pbpA
Organism
Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Amino acid sequence
>lcl|BSEQ0012992|Penicillin-binding protein 1A
MNKPTILRLIKYLSISFLSLVIAAIVLGGGVFFYYVSKAPSLSESKLVATTSSKIYDNKN
QLIADLGSERRVNAQANDIPTDLVKAIVSIEDHRFFDHRGIDTIRILGAFLRNLQSNSLQ
GGSALTQQLIKLTYFSTSTSDQTISRKAQEAWLAIQLEQKATKQEILTYYINKVYMSNGN
YGMQTAAQNYYGKDLNNLSLPQLALLAGMPQAPNQYDPYSHPEAAQDRRNLVLSEMKNQG
YISAEQYEKAVNTPITDGLQSLKSASNYPAYMDNYLKEVINQVEEETGYNLLTTGMDVYT
NVDQEAQKHLWDIYNTDEYVAYPDDELQVASTIVDVSNGKVIAQLGARHQSSNVSFGINQ
AVETNRDWGSTMKPITDYAPALEYGVYESTATIVHDEPYNYPGTNTPVYNWDRGYFGNIT
LQYALQQSRNVPAVETLNKVGLNRAKTFLNGLGIDYPSIHYSNAISSNTTESDKKYGASS
EKMAAAYAAFANGGTYYKPMYIHKVVFSDGSEKEFSNVGTRAMKETTAYMMTDMMKTVLS
YGTGRNAYLAWLPQAGKTGTSNYTDEEIENHIKTSQFVAPDELFAGYTRKYSMAVWTGYS
NRLTPLVGNGLTVAAKVYRSMMTYLSEGSNPEDWNIPEGLYRNGEFVFKNGARSTWSSPA
PQQPPSTESSSSSSDSSTSQSSSTTPSTNNSTTTNPNNNTQQSNTTPDQQNQNPQPAQP
Number of residues
719
Molecular Weight
79700.9
Theoretical pI
5.29
GO Classification
Functions
catalytic activity / penicillin binding
Processes
cell wall organization / peptidoglycan biosynthetic process / regulation of cell shape / response to antibiotic
Components
extracellular region
General Function
Penicillin binding
Specific Function
Cell wall formation.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0012993|Penicillin-binding protein 1A (pbpA)
ATGAACAAACCAACGATTCTGCGCCTAATCAAGTATCTGAGCATTAGCTTCTTAAGCTTG
GTTATCGCAGCCATTGTCTTAGGCGGAGGAGTTTTTTTCTACTACGTTAGCAAGGCTCCT
AGCCTATCCGAGAGTAAACTAGTTGCAACAACTTCTAGTAAAATCTACGACAATAAAAAT
CAACTCATTGCTGACTTGGGTTCTGAACGCCGCGTCAATGCCCAAGCTAATGATATTCCC
ACAGATTTGGTTAAGGCAATCGTTTCTATCGAAGACCATCGCTTCTTCGACCACAGGGGG
ATTGATACCATCCGTATCCTGGGAGCTTTCTTGCGCAATCTGCAAAGCAATTCCCTCCAA
GGTGGATCAGCTCTCACTCAACAGTTGATTAAGTTGACTTACTTTTCAACTTCGACTTCC
GACCAGACTATTTCTCGTAAGGCTCAGGAAGCTTGGTTAGCGATTCAGTTAGAACAAAAA
GCAACCAAGCAAGAAATCTTGACCTACTATATAAATAAGGTCTACATGTCTAATGGGAAC
TATGGAATGCAGACAGCAGCTCAAAACTACTATGGTAAAGACCTCAATAATTTAAGTTTA
CCTCAGTTAGCCTTGCTGGCTGGAATGCCTCAGGCACCAAACCAATATGACCCCTATTCA
CATCCAGAAGCAGCCCAAGACCGCCGAAACTTGGTCTTATCTGAAATGAAAAATCAAGGC
TACATCTCTGCTGAACAGTATGAGAAAGCAGTCAATACACCAATTACTGATGGGCTACAA
AGTCTCAAATCAGCAAGTAATTACCCTGCTTACATGGATAATTACCTCAAGGAAGTCATC
AATCAAGTTGAAGAAGAAACAGGCTATAACCTACTCACAACTGGGATGGATGTCTACACA
AATGTAGACCAAGAAGCTCAAAAACATCTGTGGGATATTTACAATACAGACGAATACGTT
GCCTATCCAGACGATGAATTGCAAGTCGCTTCTACCATTGTTGATGTTTCTAACGGTAAA
GTCATTGCCCAGCTAGGAGCACGCCATCAGTCAAGTAATGTTTCCTTCGGAATTAACCAA
GCAGTAGAAACAAACCGCGACTGGGGATCAACTATGAAACCGATCACAGACTATGCTCCT
GCCTTGGAGTACGGTGTCTACGAGTCAACTGCCACTATCGTTCACGATGAGCCCTATAAC
TACCCTGGGACAAATACCCCTGTTTATAACTGGGATAGGGGCTACTTTGGCAACATCACC
TTGCAATACGCCCTGCAACAATCGCGAAACGTCCCAGCCGTGGAAACTCTAAACAAGGTC
GGACTCAACCGCGCCAAGACTTTCCTAAATGGTCTCGGAATCGACTACCCAAGTATTCAC
TACTCAAATGCCATTTCAAGTAACACAACCGAATCAGACAAAAAATATGGAGCAAGTAGT
GAAAAGATGGCTGCTGCTTACGCTGCCTTTGCAAATGGTGGAACTTACTATAAACCAATG
TATATCCATAAAGTCGTCTTTAGTGATGGGAGTGAAAAAGAGTTCTCTAATGTCGGAACT
CGTGCCATGAAAGAAACGACAGCCTATATGATGACCGACATGATGAAAACAGTCTTGAGT
TATGGAACTGGACGAAATGCCTATCTTGCTTGGCTCCCTCAGGCTGGTAAAACAGGAACC
TCTAACTATACAGACGAGGAAATTGAAAACCACATCAAGACCTCTCAATTTGTAGCACCT
GATGAACTATTTGCTGGCTATACGCGTAAATATTCAATGGCTGTATGGACAGGCTATTCT
AACCGTCTGACACCACTTGTAGGCAATGGCCTTACGGTCGCTGCCAAAGTTTACCGCTCT
ATGATGACCTACCTGTCTGAAGGAAGCAATCCAGAGGATTGGAATATACCAGAGGGGCTC
TACAGAAATGGAGAATTCGTATTTAAAAATGGTGCTCGTTCTACGTGGAGCTCACCTGCT
CCACAACAACCCCCATCAACTGAAAGTTCAAGCTCATCATCAGATAGTTCAACTTCACAG
TCTAGCTCAACCACTCCAAGCACAAATAATAGTACGACTACCAATCCTAACAATAATACG
CAACAATCAAATACAACCCCTGATCAACAAAATCAGAATCCTCAACCAGCACAACCATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ8DR59
UniProtKB Entry NamePBPA_STRR6
GenBank Protein ID153767
GenBank Gene IDM90527
General References
  1. Martin C, Briese T, Hakenbeck R: Nucleotide sequences of genes encoding penicillin-binding proteins from Streptococcus pneumoniae and Streptococcus oralis with high homology to Escherichia coli penicillin-binding proteins 1a and 1b. J Bacteriol. 1992 Jul;174(13):4517-23. [PubMed:1624444]
  2. Hoskins J, Alborn WE Jr, Arnold J, Blaszczak LC, Burgett S, DeHoff BS, Estrem ST, Fritz L, Fu DJ, Fuller W, Geringer C, Gilmour R, Glass JS, Khoja H, Kraft AR, Lagace RE, LeBlanc DJ, Lee LN, Lefkowitz EJ, Lu J, Matsushima P, McAhren SM, McHenney M, McLeaster K, Mundy CW, Nicas TI, Norris FH, O'Gara M, Peery RB, Robertson GT, Rockey P, Sun PM, Winkler ME, Yang Y, Young-Bellido M, Zhao G, Zook CA, Baltz RH, Jaskunas SR, Rosteck PR Jr, Skatrud PL, Glass JI: Genome of the bacterium Streptococcus pneumoniae strain R6. J Bacteriol. 2001 Oct;183(19):5709-17. [PubMed:11544234]
  3. Pearce BJ, Yin YB, Masure HR: Genetic identification of exported proteins in Streptococcus pneumoniae. Mol Microbiol. 1993 Sep;9(5):1037-50. [PubMed:7934910]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB08375PCNOTAXIME GroupexperimentalunknownDetails
DB01140Cefadroxilapproved, vet_approved, withdrawnyesinhibitorDetails
DB00493CefotaximeapprovedyesinhibitorDetails
DB00607Nafcillinapproved, investigationalyesinhibitorDetails
DB00415Ampicillinapproved, vet_approvedyesinhibitorDetails
DB00485Dicloxacillinapproved, investigational, vet_approvedyesinhibitorDetails
DB01163Amdinocillininvestigational, withdrawnyesinhibitorDetails
DB01603Meticillinapproved, investigationalyesinhibitorDetails
DB00456Cefalotinapproved, investigational, vet_approvedyesinhibitorDetails
DB00713Oxacillinapproved, investigationalyesinhibitorDetails
DB01331CefoxitinapprovedyesinhibitorDetails
DB00567Cephalexinapproved, investigational, vet_approvedyesinhibitorDetails
DB03313Cephalosporin CexperimentalyesinhibitorDetails
DB00438CeftazidimeapprovedyesinhibitorDetails
DB08795AzidocillinexperimentalyesinhibitorDetails
DB00739Hetacillinapproved, vet_approved, withdrawnyesinhibitorDetails
DB01000CyclacillinapprovedyesinhibitorDetails