Voltage-dependent calcium channel subunit alpha-2/delta-2

Details

Name
Voltage-dependent calcium channel subunit alpha-2/delta-2
Synonyms
  • KIAA0558
  • Voltage-gated calcium channel subunit alpha-2/delta-2
Gene Name
CACNA2D2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037201|Voltage-dependent calcium channel subunit alpha-2/delta-2
MAVPARTCGASRPGPARTARPWPGCGPHPGPGTRRPTSGPPRPLWLLLPLLPLLAAPGAS
AYSFPQQHTMQHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVA
GDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIVYYDAKADAELDDPESEDVER
GSKASTLRLDFIEDPNFKNKVNYSYAAVQIPTDIYKGSTVILNELNWTEALENVFMENRR
QDPTLLWQVFGSATGVTRYYPATPWRAPKKIDLYDVRRRPWYIQGASSPKDMVIIVDVSG
SVSGLTLKLMKTSVCEMLDTLSDDDYVNVASFNEKAQPVSCFTHLVQANVRNKKVFKEAV
QGMVAKGTTGYKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDVFEKYNWPNRT
VRVFTFSVGQHNYDVTPLQWMACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGKEA
KQVQWTNVYEDALGLGLVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALNDIKRLTPN
YTLGANGYVFAIDLNGYVLLHPNLKPQTTNFREPVTLDFLDAELEDENKEEIRRSMIDGN
KGHKQIRTLVKSLDERYIDEVTRNYTWVPIRSTNYSLGLVLPPYSTFYLQANLSDQILQV
KLPISKLKDFEFLLPSSFESEGHVFIAPREYCKDLNASDNNTEFLKNFIELMEKVTPDSK
QCNNFLLHNLILDTGITQQLVERVWRDQDLNTYSLLAVFAATDGGITRVFPNKAAEDWTE
NPEPFNASFYRRSLDNHGYVFKPPHQDALLRPLELENDTVGILVSTAVELSLGRRTLRPA
VVGVKLDLEAWAEKFKVLASNRTHQDQPQKCGPNSHCEMDCEVNNEDLLCVLIDDGGFLV
LSNQNHQWDQVGRFFSEVDANLMLALYNNSFYTRKESYDYQAACAPQPPGNLGAAPRGVF
VPTVADFLNLAWWTSAAAWSLFQQLLYGLIYHSWFQADPAEAEGSPETRESSCVMKQTQY
YFGSVNASYNAIIDCGNCSRLFHAQRLTNTNLLFVVAEKPLCSQCEAGRLLQKETHSDGP
EQCELVQRPRYRRGPHICFDYNATEDTSDCGRGASFPPSLGVLVSLQLLLLLGLPPRPQP
QVLVHASRRL
Number of residues
1150
Molecular Weight
129816.095
Theoretical pI
5.62
GO Classification
Functions
calcium channel regulator activity / metal ion binding / voltage-gated calcium channel activity
Processes
calcium ion transmembrane transport / energy reserve metabolic process / muscle fiber development / neuromuscular junction development / positive regulation of organ growth / regulation of calcium ion transport / regulation of insulin secretion / regulation of multicellular organism growth / rhythmic synaptic transmission / small molecule metabolic process
Components
plasma membrane / voltage-gated calcium channel complex
General Function
Voltage-gated calcium channel activity
Specific Function
The alpha-2/delta subunit of voltage-dependent calcium channels regulates calcium current density and activation/inactivation kinetics of the calcium channel. Acts as a regulatory subunit for P/Q-type calcium channel (CACNA1A), N-type (CACNA1B), L-type (CACNA1C OR CACNA1D) and possibly T-type (CACNA1G). Overexpression induces apoptosis.
Pfam Domain Function
Transmembrane Regions
1114-1134
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0011717|Voltage-dependent calcium channel subunit alpha-2/delta-2 (CACNA2D2)
ATGGCGGTGCCGGCTCGGACCTGCGGCGCCTCTCGGCCCGGCCCAGCGCGGACTGCGCGC
CCCTGGCCCGGCTGCGGCCCCCACCCTGGCCCCGGCACCCGGCGCCCGACGTCCGGGCCC
CCGCGCCCGCTGTGGCTGCTGCTGCCGCTTCTACCGCTGCTCGCCGCCCCCGGCGCCTCT
GCCTACAGCTTCCCCCAGCAGCACACGATGCAGCACTGGGCCCGGCGTCTGGAGCAGGAG
GTCGACGGCGTGATGCGGATTTTTGGAGGCGTCCAGCAGCTCCGTGAGATTTACAAGGAC
AACCGGAACCTGTTCGAGGTACAGGAGAATGAGCCTCAGAAGTTGGTGGAGAAGGTGGCA
GGGGACATTGAGAGCCTTCTGGACAGGAAGGTGCAGGCCCTGAAGAGACTGGCTGATGCT
GCAGAGAACTTCCAGAAAGCACACCGCTGGCAGGACAACATCAAGGAGGAAGACATCGTG
TACTATGACGCCAAGGCTGACGCTGAGCTGGACGACCCTGAGAGTGAGGATGTGGAAAGG
GGGTCTAAGGCCAGCACCCTAAGGCTGGACTTCATCGAGGACCCAAACTTCAAGAACAAG
GTCAACTATTCATACGCGGCTGTACAGATCCCTACGGACATCTACAAAGGCTCCACTGTC
ATCCTCAATGAGCTCAACTGGACAGAGGCCCTGGAGAATGTGTTCATGGAAAACCGCAGA
CAAGACCCCACACTGCTGTGGCAGGTCTTCGGCAGCGCCACAGGAGTCACTCGCTACTAC
CCGGCCACCCCGTGGCGAGCCCCCAAGAAGATCGACCTGTACGATGTCCGAAGGAGACCC
TGGTATATCCAGGGGGCCTCGTCACCCAAAGACATGGTCATCATCGTGGATGTGAGTGGC
AGTGTGAGCGGCCTGACCCTGAAGCTGATGAAGACATCTGTCTGCGAGATGCTGGACACG
CTGTCTGATGATGACTATGTGAATGTGGCCTCGTTCAACGAGAAGGCACAGCCTGTGTCA
TGCTTCACACACCTGGTGCAGGCCAATGTGCGCAACAAGAAGGTGTTCAAGGAAGCTGTG
CAGGGCATGGTGGCCAAGGGCACCACAGGCTACAAGGCCGGCTTTGAGTATGCCTTTGAC
CAGCTGCAGAACTCCAACATCACTCGGGCCAACTGCAACAAGATGATCATGATGTTCACG
GATGGTGGTGAGGACCGCGTGCAGGACGTCTTTGAGAAGTACAATTGGCCAAACCGGACG
GTGCGCGTGTTTACTTTCTCCGTGGGGCAGCATAACTATGACGTCACACCGCTGCAGTGG
ATGGCCTGTGCCAACAAAGGCTACTATTTTGAGATCCCTTCCATCGGAGCCATCCGCATC
AACACACAGGAATATCTAGATGTGTTGGGCAGGCCCATGGTGCTGGCAGGCAAGGAGGCC
AAGCAGGTGCAGTGGACCAACGTGTATGAGGATGCACTGGGACTGGGGTTGGTGGTAACA
GGGACCCTCCCTGTTTTCAACCTGACACAGGATGGCCCTGGGGAAAAGAAGAACCAGCTG
ATCCTGGGCGTGATGGGCATTGACGTGGCTCTGAATGACATCAAGAGGCTGACCCCCAAC
TACACGCTTGGAGCCAACGGCTATGTGTTTGCCATTGACCTGAACGGCTACGTGTTGCTG
CACCCCAATCTCAAGCCCCAGACCACCAACTTCCGGGAGCCTGTGACTCTGGACTTCCTG
GATGCGGAGCTAGAGGATGAGAACAAGGAAGAGATCCGTCGGAGCATGATTGATGGCAAC
AAGGGCCACAAGCAGATCAGAACGTTGGTCAAGTCCCTGGATGAGAGGTACATAGATGAG
GTGACACGGAACTACACCTGGGTGCCTATAAGGAGCACTAACTACAGCCTGGGGCTGGTG
CTCCCACCCTACAGCACCTTCTACCTCCAAGCCAATCTCAGTGACCAGATCCTGCAGGTC
AAGTATTTTGAGTTCCTGCTCCCCAGCAGCTTTGAGTCTGAAGGACACGTTTTCATTGCT
CCCAGAGAGTACTGCAAGGACCTGAATGCCTCAGACAACAACACCGAGTTCCTGAAAAAC
TTTATTGAGCTCATGGAGAAAGTGACTCCAGACTCCAAGCAGTGCAACAACTTCCTTCTG
CACAACCTGATCTTGGACACGGGCATCACGCAGCAGCTGGTAGAGCGTGTGTGGAGGGAC
CAGGATCTCAACACGTACAGCCTACTGGCCGTGTTCGCTGCCACAGACGGTGGCATCACC
CGAGTCTTCCCCAACAAGGCAGCTGAGGACTGGACAGAGAACCCTGAGCCCTTCAATGCC
AGCTTCTACCGCCGCAGCCTGGATAACCACGGTTATGTCTTCAAGCCCCCACACCAGGAT
GCCCTGTTAAGGCCGCTGGAGCTGGAGAATGACACTGTGGGCATCCTCGTCAGCACAGCT
GTGGAGCTCAGCCTAGGCAGGCGCACACTGAGGCCAGCAGTGGTGGGCGTCAAGCTGGAC
CTAGAGGCTTGGGCTGAGAAGTTCAAGGTGCTAGCCAGCAACCGTACCCACCAAGACCAG
CCTCAGAAGTGCGGCCCCAACAGCCACTGTGAGATGGACTGCGAGGTTAACAATGAGGAC
TTACTCTGTGTCCTCATTGATGATGGAGGATTCCTGGTGCTGTCAAACCAGAACCATCAG
TGGGACCAGGTGGGCAGGTTCTTCAGTGAGGTGGATGCCAACCTGATGCTGGCACTCTAC
AATAACTCCTTCTACACCCGCAAGGAGTCCTATGACTATCAGGCAGCCTGTGCCCCTCAG
CCCCCTGGCAACCTGGGTGCTGCACCCCGGGGTGTCTTTGTGCCCACCGTTGCAGATTTC
CTTAACCTGGCCTGGTGGACCTCTGCTGCCGCCTGGTCCCTGTTCCAGCAGCTTCTCTAC
GGCCTCATCTACCACAGCTGGTTCCAAGCAGACCCCGCGGAGGCCGAGGGGAGCCCCGAG
ACGCGCGAGAGCAGCTGCGTCATGAAACAGACCCAGTACTACTTCGGCTCGGTAAACGCC
TCCTACAACGCCATCATCGACTGCGGAAACTGCTCCAGGCTGTTCCACGCGCAGAGACTG
ACCAACACCAATCTTCTCTTTGTGGTGGCCGAGAAGCCGCTGTGCAGCCAGTGCGAGGCT
GGCCGGCTGCTGCAGAAGGAGACGCACTGCCCAGCGGACGGCCCGGAGCAGTGTGAGCTA
GTGCAGAGACCGCGATACCGGAGAGGCCCGCACATCTGCTTCGACTACAACGCGACAGAA
GATACCTCAGACTGTGGCCGCGGGGCCTCCTTCCCGCCGTCGCTGGGCGTCCTGGTCTCC
CTGCAACTGCTGCTCCTCCTGGGCCTGCCGCCCCGGCCGCAGCCTCAAGTCCTCGTCCAC
GCCTCTCGCCGCCTCTGA
Chromosome Location
3
Locus
3p21.3
External Identifiers
ResourceLink
UniProtKB IDQ9NY47
UniProtKB Entry NameCA2D2_HUMAN
GenBank Gene IDAJ251368
GenAtlas IDCACNA2D2
HGNC IDHGNC:1400
General References
  1. Klugbauer N, Lacinova L, Marais E, Hobom M, Hofmann F: Molecular diversity of the calcium channel alpha2delta subunit. J Neurosci. 1999 Jan 15;19(2):684-91. [PubMed:9880589]
  2. Gao B, Sekido Y, Maximov A, Saad M, Forgacs E, Latif F, Wei MH, Lerman M, Lee JH, Perez-Reyes E, Bezprozvanny I, Minna JD: Functional properties of a new voltage-dependent calcium channel alpha(2)delta auxiliary subunit gene (CACNA2D2). J Biol Chem. 2000 Apr 21;275(16):12237-42. [PubMed:10766861]
  3. Hobom M, Dai S, Marais E, Lacinova L, Hofmann F, Klugbauer N: Neuronal distribution and functional characterization of the calcium channel alpha2delta-2 subunit. Eur J Neurosci. 2000 Apr;12(4):1217-26. [PubMed:10762351]
  4. Nagase T, Ishikawa K, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1998 Feb 28;5(1):31-9. [PubMed:9628581]
  5. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  7. Gong HC, Hang J, Kohler W, Li L, Su TZ: Tissue-specific expression and gabapentin-binding properties of calcium channel alpha2delta subunit subtypes. J Membr Biol. 2001 Nov 1;184(1):35-43. [PubMed:11687876]
  8. Klugbauer N, Marais E, Hofmann F: Calcium channel alpha2delta subunits: differential expression, function, and drug binding. J Bioenerg Biomembr. 2003 Dec;35(6):639-47. [PubMed:15000524]
  9. Carboni GL, Gao B, Nishizaki M, Xu K, Minna JD, Roth JA, Ji L: CACNA2D2-mediated apoptosis in NSCLC cells is associated with alterations of the intracellular calcium signaling and disruption of mitochondria membrane integrity. Oncogene. 2003 Jan 30;22(4):615-26. [PubMed:12555074]
  10. Lacinova L, Klugbauer N: Modulation of gating currents of the Ca(v)3.1 calcium channel by alpha 2 delta 2 and gamma 5 subunits. Arch Biochem Biophys. 2004 May 15;425(2):207-13. [PubMed:15111129]
  11. Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD: Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins. Nat Biotechnol. 2009 Apr;27(4):378-86. doi: 10.1038/nbt.1532. Epub 2009 Apr 6. [PubMed:19349973]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00996Gabapentinapproved, investigationalyesinhibitorDetails
DB08872Gabapentin enacarbilapproved, investigationalunknownDetails
DB01023Felodipineapproved, investigationalunknowninhibitorDetails
DB00270Isradipineapproved, investigationalyesinhibitorDetails
DB01054Nitrendipineapproved, investigationalunknowninhibitorDetails
DB01118Amiodaroneapproved, investigationalyesinhibitorDetails
DB01244Bepridilapproved, withdrawnyesinhibitorDetails
DB00421SpironolactoneapprovedunknowninhibitorDetails
DB11148Butambenapproved, withdrawnyesinhibitorDetails
DB00381AmlodipineapprovedyesblockerDetails
DB00153Ergocalciferolapproved, nutraceuticalnoinducerDetails