Banner
Identification
Name Darbepoetin alfa
Accession Number DB00012 (BIOD00032, BTD00032)
Type biotech
Groups approved
Description

Human erythropoietin with 2 aa substitutions to enhance glycosylation (5 N-linked chains), 165 residues (MW=37 kD). Produced in Chinese hamster ovary (CHO) cells by recombinant DNA technology.

Protein structure Db00012
Display: 3D Structure
Protein chemical formula C815H1317N233O241S5
Protein average weight 18396.1000
Sequences
>DB00012 sequence
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQA
VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS
PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

FASTA
Synonyms
Epoetin
Erythropoietin precursor
Salts Not Available
Brand names
Name Company
Aranesp Amgen Inc.
Brand mixtures Not Available
Categories
  • Antianemic Agents
CAS number 11096-26-7
Taxonomy
Kingdom Not Available
Classes Not Available
Substructures Not Available
Pharmacology
Indication For the treatment of anemia (from renal transplants or certain HIV treatment)
Pharmacodynamics Darbepoetin alfa is used in the treatment of anemia. It is involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of action Darbepoetin alfa stimulates erythropoiesis by the same mechanism as endogenous erythropoietin. Erythropoietin interacts with progenitor stem cells to increase red cell production. Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization, which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Absorption Not Available
Volume of distribution Not Available
Protein binding Not Available
Metabolism Not Available
Route of elimination Not Available
Half life Not Available
Clearance Not Available
Toxicity Not Available
Affected organisms
  • Humans and other mammals
Pathways Not Available
Pharmacoeconomics
Manufacturers
  • Amgen Inc.
Packagers
Dosage forms
Form Route Strength
Solution Intravenous
Prices
Unit description Cost Unit
Aranesp (Albumin Free) 150 mcg/0.75ml Solution (1 Box = Four 0.75ml Vials) 3902.75 USD box
Aranesp (Albumin Free) 100 mcg/0.5ml Solution (1 Box = Four 0.5ml Syringes) 2601.83 USD box
Aranesp (Albumin Free) 100 mcg/ml Solution Four 1ml Vials Per Box 2601.83 USD box
Aranesp (Albumin Free) 300 mcg/ml vial 1951.37 USD vial
Aranesp 300 mcg/ml vial 1876.32 USD ml
Aranesp 200 mcg/ml vial 1250.88 USD ml
Aranesp 100 mcg/ml vial 625.44 USD ml
Aranesp (Albumin Free) 60 mcg/ml vial 390.31 USD vial
Aranesp 60 mcg/ml vial 375.3 USD ml
Aranesp 40 mcg/ml vial 250.2 USD ml
Aranesp (Albumin Free) 25 mcg/ml vial 162.61 USD vial
Aranesp 25 mcg/ml vial 156.36 USD ml
First Prev Next Last
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Country Patent Number Approved Expires (estimated)
Canada 2165694 2003-03-18 2010-10-15
Canada 2147124 2002-11-05 2014-08-16
Properties
State liquid
Experimental Properties
Property Value Source
melting point 53 °C Arakawa, T. et al., Biosci. Biotechnol. Biochem. 65:1321-1327 (2001)
hydrophobicity -0.188 Not Available
isoelectric point 8.75 Not Available
References
Synthesis Reference Not Available
General Reference Not Available
External Links
Resource Link
UniProt P01588 Link_out
Genbank X02158 Link_out
PharmGKB PA164743138 Link_out
Drug Product Database 2246360 Link_out
RxList http://www.rxlist.com/cgi/generic/aranesp.htm Link_out
Drugs.com http://www.drugs.com/cdi/darbepoetin-alfa-albumin.html Link_out
Wikipedia http://en.wikipedia.org/wiki/Darbepoetin_alfa Link_out
ATC Codes
  • B03XA02
AHFS Codes
  • 20:16.00
PDB Entries
FDA label Not Available
MSDS Not Available
Interactions
Drug Interactions Searched, but no interactions found.
Food Interactions Not Available
Targets

1. Erythropoietin receptor

Pharmacological action: yes
Actions: agonist

Isoform EPOR-T, missing the cytoplasmic tail, acts as a dominant-negative receptor of EPOR-mediated signaling

Organism class: human
UniProt ID: P19235 Link_out
Gene: EPOR Link_out
Protein Sequence: FASTA
Gene Sequence: FASTA
SNPs: SNPJam Report Link_out

References:
  1. LaMontagne KR, Butler J, Marshall DJ, Tullai J, Gechtman Z, Hall C, Meshaw A, Farrell FX: Recombinant epoetins do not stimulate tumor growth in erythropoietin receptor-positive breast carcinoma models. Mol Cancer Ther. 2006 Feb;5(2):347-55. Pubmed
  2. Kokhaei P, Abdalla AO, Hansson L, Mikaelsson E, Kubbies M, Haselbeck A, Jernberg-Wiklund H, Mellstedt H, Osterborg A: Expression of erythropoietin receptor and in vitro functional effects of epoetins in B-cell malignancies. Clin Cancer Res. 2007 Jun 15;13(12):3536-44. Pubmed
  3. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. Pubmed

Comments
Drug created on June 13, 2005 07:24 / Updated on September 03, 2011 16:35