Banner
Identification
Name Epoetin alfa
Accession Number DB00016 (BIOD00103, BTD00103)
Type biotech
Groups approved
Description

Human erythropoietin (recombinant), produced by CHO cells.
Protein structure Db00016
Display: 3D Structure
Protein chemical formula C815H1317N233O241S5
Protein average weight 18396.1000
Sequences 
>DB00016 sequence
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQA
VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS
PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

FASTA
Synonyms
Epoetin
Erythropoietin precursor
Salts Not Available
Brand names
Name Company
Epogen
Epogen (Amgen Inc.)
Epogin (Chugai)
Epomax (Elanex)
Eprex Janssen-Cilag. Ortho Biologics LLC
NeoRecormon (Roche)
Procrit
Procrit (Ortho Biotech)
Recormon (Roche)
Brand mixtures Not Available
Categories
  • Antianemic Agents
CAS number 113427-24-0
Taxonomy
Kingdom Not Available
Classes Not Available
Substructures Not Available
Pharmacology
Indication For treatment of anemia (from renal transplants or certain HIV treatment)
Pharmacodynamics Used in the treatment of anemia. Involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of action Binding of erythropoietin to the erythropoietin receptor leads to receptor dimerization, which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
Absorption Not Available
Volume of distribution Not Available
Protein binding Not Available
Metabolism Not Available
Route of elimination Not Available
Half life Not Available
Clearance
  • 20.2 +/- 15.9 mL/h/kg [150 Units/kg SC TIW, Week 1 when anemic cancer patients were receiving chemotherapy]
  • 23.6 +/- 9.5 mL/h/kg [150 Units/kg SC TIW, Week 3 when anemic cancer patients were not receiving chemotherapy]
  • 9.2 +/- 4.7 mL/h/kg [40,000 Units/kg SC TIW, Week 1 when anemic cancer patients were receiving chemotherapy]
  • 13.9 +/- 7.6 mL/h/kg [40,000 Units/kg SC TIW, Week 3 when anemic cancer patients were not receiving chemotherapy]
Toxicity Not Available
Affected organisms
  • Humans and other mammals
Pathways Not Available
Pharmacoeconomics
Manufacturers Not Available
Packagers
Dosage forms
Form Route Strength
Liquid Subcutaneous
Solution Intravenous
Solution Subcutaneous
Prices
Unit description Cost Unit
Epogen 40000 unit/ml Solution 1 Box Contains Ten 1ml Vials 6852.3 USD box
Epogen 20000 unit/ml Solution 1 Box Contains Ten 1ml Vials 3157.44 USD box
Epogen 10000 unit/ml Solution 1 Box Contains Ten 1ml Vials 1578.72 USD box
Procrit 40000 unit/ml vial 767.03 USD vial
Procrit 10000 unit/ml vial 710.87 USD vial
Epogen 40000 unit/ml vial 640.37 USD ml
Procrit 20000 unit/ml vial 388.97 USD ml
Procrit 20000 unit/ml Solution 378.14 USD ml
Procrit 10000 unit/ml Solution 2ml Vial 358.02 USD vial
Epogen 10000 unit/ml Solution 2ml Vial 315.74 USD vial
Epogen 20000 unit/ml vial 303.6 USD ml
Epogen 10000 unit/ml vial 151.8 USD ml
Procrit 4000 unit/ml vial 74.17 USD vial
Epogen 4000 unit/ml vial 61.34 USD vial
Procrit 3000 unit/ml vial 55.63 USD vial
Epogen 3000 unit/ml vial 47.53 USD vial
Procrit 2000 unit/ml vial 37.09 USD vial
Epogen 2000 unit/ml vial 34.14 USD vial
First Prev Next Last
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Country Patent Number Approved Expires (estimated)
Canada 1339047 1997-05-27 2014-05-27
Properties
State liquid
Experimental Properties
Property Value Source
melting point 53 °C Arakawa, T. et al., Biosci. Biotechnol. Biochem. 65:1321-1327 (2001)
isoelectric point 8.75 Not Available
References
Synthesis Reference Not Available
General Reference Not Available
External Links
Resource Link
UniProt P01588 Link_out
Genbank X02158 Link_out
PharmGKB PA10072 Link_out
Drug Product Database 2243403 Link_out
RxList http://www.rxlist.com/cgi/generic/epoetin.htm Link_out
Drugs.com http://www.drugs.com/cdi/epoetin-alfa.html Link_out
Wikipedia http://en.wikipedia.org/wiki/Epoetin_alfa Link_out
ATC Codes
  • B03XA02
  • B03XA01
AHFS Codes
  • 20:16.00
PDB Entries
FDA label show (2.73 MB)
MSDS Not Available
Interactions
Drug Interactions Searched, but no interactions found.
Food Interactions Not Available
Targets

1. Erythropoietin receptor

Pharmacological action: yes
Actions: agonist

Isoform EPOR-T, missing the cytoplasmic tail, acts as a dominant-negative receptor of EPOR-mediated signaling

Organism class: human
UniProt ID: P19235 Link_out
Gene: EPOR Link_out
Protein Sequence: FASTA
Gene Sequence: FASTA
SNPs: SNPJam Report Link_out

References:
  1. LaMontagne KR, Butler J, Marshall DJ, Tullai J, Gechtman Z, Hall C, Meshaw A, Farrell FX: Recombinant epoetins do not stimulate tumor growth in erythropoietin receptor-positive breast carcinoma models. Mol Cancer Ther. 2006 Feb;5(2):347-55. Pubmed
  2. Kokhaei P, Abdalla AO, Hansson L, Mikaelsson E, Kubbies M, Haselbeck A, Jernberg-Wiklund H, Mellstedt H, Osterborg A: Expression of erythropoietin receptor and in vitro functional effects of epoetins in B-cell malignancies. Clin Cancer Res. 2007 Jun 15;13(12):3536-44. Pubmed
  3. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. Pubmed
Comments
Drug created on June 13, 2005 07:24 / Updated on August 02, 2011 22:55