You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameEpoetin alfa
Accession NumberDB00016  (BIOD00103, BTD00103)
TypeBiotech
GroupsApproved
Description

Human erythropoietin (recombinant), produced by CHO cells.

Protein structureDb00016
Protein chemical formulaC815H1317N233O241S5
Protein average weight18396.1000
Sequences
>DB00016 sequence
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQA
VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS
PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Download FASTA Format
Synonyms
SynonymLanguageCode
Erythropoietin precursorNot AvailableNot Available
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Procritinjection, solution10000 [iU]/mLintravenous; subcutaneousPhysicians Total Care, Inc.1994-08-11Not AvailableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Procritinjection, solution20000 [iU]/mLintravenous; subcutaneousPhysicians Total Care, Inc.2008-03-24Not AvailableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Procritinjection, solution40000 [iU]/mLintravenous; subcutaneousPhysicians Total Care, Inc.2007-08-13Not AvailableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Epogensolution2000 [iU]/mLintravenous; subcutaneousAmgen Inc1989-06-30Not AvailableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Epogensolution10000 [iU]/mLintravenous; subcutaneousAmgen Inc1993-08-16Not AvailableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Epogensolution4000 [iU]/mLintravenous; subcutaneousAmgen Inc1993-08-16Not AvailableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Epogensolution3000 [iU]/mLintravenous; subcutaneousAmgen Inc1990-04-30Not AvailableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Epogensolution10000 [iU]/mLintravenous; subcutaneousAmgen Inc1994-12-05Not AvailableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Epogensolution20000 [iU]/mLintravenous; subcutaneousAmgen Inc1997-03-03Not AvailableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Procritinjection, solution2000 [iU]/mLintravenous; subcutaneousJanssen Products, LP1989-06-01Not AvailableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Procritinjection, solution3000 [iU]/mLintravenous; subcutaneousJanssen Products, LP1989-06-01Not AvailableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Procritinjection, solution4000 [iU]/mLintravenous; subcutaneousJanssen Products, LP1989-06-01Not AvailableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Procritinjection, solution10000 [iU]/mLintravenous; subcutaneousJanssen Products, LP1989-06-01Not AvailableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Procritinjection, solution10000 [iU]/mLintravenous; subcutaneousJanssen Products, LP1989-06-01Not AvailableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Procritinjection, solution20000 [iU]/mLintravenous; subcutaneousJanssen Products, LP1989-06-01Not AvailableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Procritinjection, solution40000 [iU]/mLintravenous; subcutaneousJanssen Products, LP1989-06-01Not AvailableUs 0a2ef1ad1c84951dc1392a8bbe1f3cb241c91ed59e44ad8268635315440d978c
Generic Prescription ProductsNot Available
Over the Counter ProductsNot Available
International Brands
NameCompany
BinocritSandoz
EpoceptLupin pharma
EpofitIntas pharma
EpoginChugai
EprexJanssen-Cilag. Ortho Biologics LLC
NanokineNanogen Pharmaceutical biotechnology, Vietnam)
Brand mixturesNot Available
SaltsNot Available
Categories
CAS number113427-24-0
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationFor treatment of anemia (from renal transplants or certain HIV treatment)
PharmacodynamicsUsed in the treatment of anemia. Involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of actionBinding of erythropoietin to the erythropoietin receptor leads to receptor dimerization, which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
MetabolismNot Available
Route of eliminationNot Available
Half lifeNot Available
Clearance
  • 20.2 +/- 15.9 mL/h/kg [150 Units/kg SC TIW, Week 1 when anemic cancer patients were receiving chemotherapy]
  • 23.6 +/- 9.5 mL/h/kg [150 Units/kg SC TIW, Week 3 when anemic cancer patients were not receiving chemotherapy]
  • 9.2 +/- 4.7 mL/h/kg [40,000 Units/kg SC TIW, Week 1 when anemic cancer patients were receiving chemotherapy]
  • 13.9 +/- 7.6 mL/h/kg [40,000 Units/kg SC TIW, Week 3 when anemic cancer patients were not receiving chemotherapy]
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Injection, solutionintravenous; subcutaneous10000 [iU]/mL
Injection, solutionintravenous; subcutaneous2000 [iU]/mL
Injection, solutionintravenous; subcutaneous20000 [iU]/mL
Injection, solutionintravenous; subcutaneous3000 [iU]/mL
Injection, solutionintravenous; subcutaneous4000 [iU]/mL
Injection, solutionintravenous; subcutaneous40000 [iU]/mL
Solutionintravenous; subcutaneous10000 [iU]/mL
Solutionintravenous; subcutaneous2000 [iU]/mL
Solutionintravenous; subcutaneous20000 [iU]/mL
Solutionintravenous; subcutaneous3000 [iU]/mL
Solutionintravenous; subcutaneous4000 [iU]/mL
Prices
Unit descriptionCostUnit
Epogen 40000 unit/ml Solution 1 Box Contains Ten 1ml Vials6852.3USD box
Epogen 20000 unit/ml Solution 1 Box Contains Ten 1ml Vials3157.44USD box
Epogen 10000 unit/ml Solution 1 Box Contains Ten 1ml Vials1578.72USD box
Procrit 40000 unit/ml vial767.03USD vial
Procrit 10000 unit/ml vial710.87USD vial
Epogen 40000 unit/ml vial640.37USD ml
Procrit 20000 unit/ml vial388.97USD ml
Procrit 20000 unit/ml Solution378.14USD ml
Procrit 10000 unit/ml Solution 2ml Vial358.02USD vial
Epogen 10000 unit/ml Solution 2ml Vial315.74USD vial
Epogen 20000 unit/ml vial303.6USD ml
Epogen 10000 unit/ml vial151.8USD ml
Procrit 4000 unit/ml vial74.17USD vial
Epogen 4000 unit/ml vial61.34USD vial
Procrit 3000 unit/ml vial55.63USD vial
Epogen 3000 unit/ml vial47.53USD vial
Procrit 2000 unit/ml vial37.09USD vial
Epogen 2000 unit/ml vial34.14USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
CountryPatent NumberApprovedExpires (estimated)
Canada13390471997-05-272014-05-27
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point53 °CArakawa, T. et al., Biosci. Biotechnol. Biochem. 65:1321-1327 (2001)
isoelectric point8.75Not Available
References
Synthesis ReferenceNot Available
General ReferenceNot Available
External Links
ATC CodesNot Available
AHFS Codes
  • 20:16.00
PDB Entries
FDA labelDownload (2.73 MB)
MSDSNot Available
Interactions
Drug Interactions
Drug
LenalidomideErythropoiesis-Stimulating Agents may enhance the thrombogenic effect of Lenalidomide.
ThalidomideErythropoiesis-Stimulating Agents may enhance the thrombogenic effect of Thalidomide.
Food InteractionsNot Available

Targets

1. Erythropoietin receptor

Kind: protein

Organism: Human

Pharmacological action: yes

Actions: agonist

Components

Name UniProt ID Details
Erythropoietin receptor P19235 Details

References:

  1. LaMontagne KR, Butler J, Marshall DJ, Tullai J, Gechtman Z, Hall C, Meshaw A, Farrell FX: Recombinant epoetins do not stimulate tumor growth in erythropoietin receptor-positive breast carcinoma models. Mol Cancer Ther. 2006 Feb;5(2):347-55. Pubmed
  2. Kokhaei P, Abdalla AO, Hansson L, Mikaelsson E, Kubbies M, Haselbeck A, Jernberg-Wiklund H, Mellstedt H, Osterborg A: Expression of erythropoietin receptor and in vitro functional effects of epoetins in B-cell malignancies. Clin Cancer Res. 2007 Jun 15;13(12):3536-44. Pubmed
  3. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. Pubmed

Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on August 02, 2011 22:55