You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameEpoetin alfa
Accession NumberDB00016  (BIOD00103, BTD00103)
Typebiotech
Groupsapproved
Description

Human erythropoietin (recombinant), produced by CHO cells.

Protein structureDb00016
Protein chemical formulaC815H1317N233O241S5
Protein average weight18396.1000
Sequences
>DB00016 sequence
APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQA
VEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAIS
PPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Download FASTA Format
Synonyms
SynonymLanguageCode
Erythropoietin precursorNot AvailableNot Available
SaltsNot Available
Brand names
NameCompany
BinocritSandoz
EpoceptLupin pharma
EpofitIntas pharma
EpogenAmgen Inc.
EpoginChugai
EprexJanssen-Cilag. Ortho Biologics LLC
NanokineNanogen Pharmaceutical biotechnology, Vietnam)
ProcritOrtho Biotech
Brand mixturesNot Available
Categories
CAS number113427-24-0
Taxonomy
KingdomOrganic Compounds
SuperclassOrganic Acids
ClassCarboxylic Acids and Derivatives
SubclassAmino Acids, Peptides, and Analogues
Direct parentPeptides
Alternative parentsNot Available
SubstituentsNot Available
Classification descriptionNot Available
Pharmacology
IndicationFor treatment of anemia (from renal transplants or certain HIV treatment)
PharmacodynamicsUsed in the treatment of anemia. Involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.
Mechanism of actionBinding of erythropoietin to the erythropoietin receptor leads to receptor dimerization, which facilitates activation of JAK-STAT signaling pathways within the cytosol. Activated STAT (signal transducers and activators of transcription) proteins are then translocated to the nucleus where they serve as transcription factors which regulate the activation of specific genes involved in cell division or differentiation.
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
Metabolism
Route of eliminationNot Available
Half lifeNot Available
Clearance
  • 20.2 +/- 15.9 mL/h/kg [150 Units/kg SC TIW, Week 1 when anemic cancer patients were receiving chemotherapy]
  • 23.6 +/- 9.5 mL/h/kg [150 Units/kg SC TIW, Week 3 when anemic cancer patients were not receiving chemotherapy]
  • 9.2 +/- 4.7 mL/h/kg [40,000 Units/kg SC TIW, Week 1 when anemic cancer patients were receiving chemotherapy]
  • 13.9 +/- 7.6 mL/h/kg [40,000 Units/kg SC TIW, Week 3 when anemic cancer patients were not receiving chemotherapy]
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
LiquidSubcutaneous
SolutionIntravenous
SolutionSubcutaneous
Prices
Unit descriptionCostUnit
Epogen 40000 unit/ml Solution 1 Box Contains Ten 1ml Vials6852.3USDbox
Epogen 20000 unit/ml Solution 1 Box Contains Ten 1ml Vials3157.44USDbox
Epogen 10000 unit/ml Solution 1 Box Contains Ten 1ml Vials1578.72USDbox
Procrit 40000 unit/ml vial767.03USDvial
Procrit 10000 unit/ml vial710.87USDvial
Epogen 40000 unit/ml vial640.37USDml
Procrit 20000 unit/ml vial388.97USDml
Procrit 20000 unit/ml Solution378.14USDml
Procrit 10000 unit/ml Solution 2ml Vial358.02USDvial
Epogen 10000 unit/ml Solution 2ml Vial315.74USDvial
Epogen 20000 unit/ml vial303.6USDml
Epogen 10000 unit/ml vial151.8USDml
Procrit 4000 unit/ml vial74.17USDvial
Epogen 4000 unit/ml vial61.34USDvial
Procrit 3000 unit/ml vial55.63USDvial
Epogen 3000 unit/ml vial47.53USDvial
Procrit 2000 unit/ml vial37.09USDvial
Epogen 2000 unit/ml vial34.14USDvial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
CountryPatent NumberApprovedExpires (estimated)
Canada13390471997-05-272014-05-27
Properties
Stateliquid
Experimental Properties
PropertyValueSource
melting point53 °CArakawa, T. et al., Biosci. Biotechnol. Biochem. 65:1321-1327 (2001)
isoelectric point8.75Not Available
References
Synthesis ReferenceNot Available
General ReferenceNot Available
External Links
ResourceLink
UniProtP01588
GenbankX02158
PharmGKBPA10072
Drug Product Database2243403
RxListhttp://www.rxlist.com/cgi/generic/epoetin.htm
Drugs.comhttp://www.drugs.com/cdi/epoetin-alfa.html
WikipediaEpoetin_alfa
ATC CodesB03XA01
AHFS Codes
  • 20:16.00
PDB Entries
FDA labelshow(2.73 MB)
MSDSNot Available
Interactions
Drug InteractionsSearched, but no interactions found.
Food InteractionsNot Available

Targets

1. Erythropoietin receptor

Kind: protein

Organism: Human

Pharmacological action: yes

Actions: agonist

Components

Name UniProt ID Details
Erythropoietin receptor P19235 Details

References:

  1. LaMontagne KR, Butler J, Marshall DJ, Tullai J, Gechtman Z, Hall C, Meshaw A, Farrell FX: Recombinant epoetins do not stimulate tumor growth in erythropoietin receptor-positive breast carcinoma models. Mol Cancer Ther. 2006 Feb;5(2):347-55. Pubmed
  2. Kokhaei P, Abdalla AO, Hansson L, Mikaelsson E, Kubbies M, Haselbeck A, Jernberg-Wiklund H, Mellstedt H, Osterborg A: Expression of erythropoietin receptor and in vitro functional effects of epoetins in B-cell malignancies. Clin Cancer Res. 2007 Jun 15;13(12):3536-44. Pubmed
  3. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. Pubmed

Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on August 02, 2011 22:55