| Identification | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Name | Alpha-1-proteinase inhibitor | |||||||||||||||||||||||||||
| Accession Number | DB00058 (BIOD00002, BTD00002) | |||||||||||||||||||||||||||
| Type | biotech | |||||||||||||||||||||||||||
| Groups | approved | |||||||||||||||||||||||||||
| Description | Human alpha-1 proteinase inhibitor or alpha-1-antitrypsin, prepared from human plasma via Cohn alcohol fractionation followed by PEG and zinc chloride fractionation. |
|||||||||||||||||||||||||||
| Protein structure |
Display: 3D Structure |
|||||||||||||||||||||||||||
| Protein chemical formula | C2001H3130N514O601S10 | |||||||||||||||||||||||||||
| Protein average weight | 44324.5000 | |||||||||||||||||||||||||||
| Sequences |
>DB00058 sequence EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATA FAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFL SEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDT VFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVL LMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLK SVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSI PPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK FASTA |
|||||||||||||||||||||||||||
| Synonyms |
|
|||||||||||||||||||||||||||
| Salts | Not Available | |||||||||||||||||||||||||||
| Brand names |
|
|||||||||||||||||||||||||||
| Brand mixtures | Not Available | |||||||||||||||||||||||||||
| Categories |
|
|||||||||||||||||||||||||||
| CAS number | 9041-92-3 | |||||||||||||||||||||||||||
| Taxonomy | ||||||||||||||||||||||||||||
| Kingdom | Not Available | |||||||||||||||||||||||||||
| Classes | Not Available | |||||||||||||||||||||||||||
| Substructures | Not Available | |||||||||||||||||||||||||||
| Pharmacology | ||||||||||||||||||||||||||||
| Indication | For treatment of panacinar emphysema | |||||||||||||||||||||||||||
| Pharmacodynamics | Prevents excessive accumulation of active neutrophil elastase and consequent proteolysis of elastin tissues in alveolar lung structures. This prevents the development of emphysema. | |||||||||||||||||||||||||||
| Mechanism of action | Alpha-1 proteinase inhibitor is a serine protease inhibitor (Serpin). Its primary mechanism is inhibiting the action of the serine protease called elastase (also plasmin and thrombin) in the lungs. The reactive center loop (RCL) of alpha-1 proteinase inhibitor extends out from the body of the protein and directs binding to the target protease. The protease cleaves the serpin at the reactive site, establishing a covalent linkage between the carboxyl group of the serpin reactive site and the serine hydroxyl of the protease. The resulting inactive serpin-protease complex is highly stable. | |||||||||||||||||||||||||||
| Absorption | Not Available | |||||||||||||||||||||||||||
| Volume of distribution |
|
|||||||||||||||||||||||||||
| Protein binding | Not Available | |||||||||||||||||||||||||||
| Metabolism |
Not Available
|
|||||||||||||||||||||||||||
| Route of elimination | Not Available | |||||||||||||||||||||||||||
| Half life | Not Available | |||||||||||||||||||||||||||
| Clearance |
|
|||||||||||||||||||||||||||
| Toxicity | Not Available | |||||||||||||||||||||||||||
| Affected organisms |
|
|||||||||||||||||||||||||||
| Pathways | Not Available | |||||||||||||||||||||||||||
| Pharmacoeconomics | ||||||||||||||||||||||||||||
| Manufacturers | Not Available | |||||||||||||||||||||||||||
| Packagers | ||||||||||||||||||||||||||||
| Dosage forms |
|
|||||||||||||||||||||||||||
| Prices |
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational
purposes only.
|
|||||||||||||||||||||||||||
| Patents | Not Available | |||||||||||||||||||||||||||
| Properties | ||||||||||||||||||||||||||||
| State | liquid | |||||||||||||||||||||||||||
| Experimental Properties |
|
|||||||||||||||||||||||||||
| References | ||||||||||||||||||||||||||||
| Synthesis Reference | Not Available | |||||||||||||||||||||||||||
| General Reference |
|
|||||||||||||||||||||||||||
| External Links |
|
|||||||||||||||||||||||||||
| ATC Codes | Not Available | |||||||||||||||||||||||||||
| AHFS Codes | Not Available | |||||||||||||||||||||||||||
| PDB Entries | ||||||||||||||||||||||||||||
| FDA label | Not Available | |||||||||||||||||||||||||||
| MSDS | Not Available | |||||||||||||||||||||||||||
| Interactions | ||||||||||||||||||||||||||||
| Drug Interactions | Not Available | |||||||||||||||||||||||||||
| Food Interactions | Not Available | |||||||||||||||||||||||||||
| Targets |
|---|
|
Pharmacological action: yes
Actions: inhibitor Modifies the functions of natural killer cells, monocytes and granulocytes. Inhibits C5a-dependent neutrophil enzyme release and chemotaxis Organism class: humanUniProt ID: P08246 ![]() Gene: ELA2 ![]() Protein Sequence: FASTA Gene Sequence: FASTA SNPs: SNPJam Report ![]() References:
|
| Comments |
|---|