You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameInterferon Alfa-2b, Recombinant
Accession NumberDB00105  (BTD00066, BIOD00066)
TypeBiotech
GroupsApproved
Description

Interferon alpha 2b (human leukocyte clone hif-sn 206 protein moiety reduced). A type I interferon consisting of 165 amino acid residues with arginine in position 23. This protein is produced by recombinant DNA technology and resembles interferon secreted by leukocytes. It is used extensively as an antiviral or antineoplastic agent.

Protein structureDb00105
Related Articles
Protein chemical formulaC860H1353N229O255S9
Protein average weight19271.0 Da
Sequences
>DB00105 sequence
CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMI
QQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVR
KYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Download FASTA Format
Synonyms
Interferon alfa-2b
Interferon α-2b
Intron (Interferon α2b)
Intron A
Intron A (Interferon α2b)
rIFN-alpha-2b
External Identifiers
  • 99210-65-8
  • Sch 30500
  • YM 14090
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Intron Asolution6000000 unitintramuscular; intravenous; subcutaneousMerck Canada Inc1998-12-10Not applicableCanada
Intron AkitMerck Sharp & Dohme Corp.1986-06-042016-04-23Us
Intron AkitMerck Sharp & Dohme Corp.2014-08-112016-04-23Us
Intron AkitMerck Sharp & Dohme Corp.2014-08-112016-04-23Us
Intron AkitMerck Sharp & Dohme Corp.2014-08-112016-04-23Us
Intron Aliquid50000000 unitsubcutaneousMerck Canada Inc1999-09-23Not applicableCanada
Intron Ainjection, solution11.6 ug/.5mLintramuscular; subcutaneousMerck Sharp & Dohme Corp.1986-06-042016-04-23Us
Intron Aliquid25000000 unitsubcutaneousMerck Canada Inc1999-09-23Not applicableCanada
Intron Ainjection, solution19.2 ug/.5mLintralesional; intramuscular; subcutaneousMerck Sharp & Dohme Corp.1986-06-042016-04-23Us
Intron Aliquid15000000 unitsubcutaneousMerck Canada Inc1999-09-23Not applicableCanada
Intron AkitMerck Sharp & Dohme Corp.1986-06-042016-04-23Us
Intron Asolution10000000 unitintramuscular; intravenous; subcutaneousMerck Canada Inc1998-12-10Not applicableCanada
Intron AkitMerck Sharp & Dohme Corp.1986-06-042016-04-23Us
Intron A - Liq 5000000iu/mlliquid5000000 unitintralesional; intramuscular; subcutaneousSchering Plough (Brinny) Co.1997-09-252001-07-18Canada
Intron A Inj 10000000unit/vialliquid10000000 unitsubcutaneousAvondale (Brinny) Chemical Company1986-12-311999-07-22Canada
Intron A Inj 3000000unit/vialliquid3000000 unitsubcutaneousAvondale (Brinny) Chemical Company1986-12-311999-07-22Canada
Intron A Inj 5000000unit/vialliquid5000000 unitsubcutaneousAvondale (Brinny) Chemical Company1986-12-311999-07-22Canada
Generic Prescription ProductsNot Available
Over the Counter ProductsNot Available
International BrandsNot Available
Brand mixtures
NameLabellerIngredients
Intron AMerck Canada Inc
Intron A - Kit (pws+diluent) 3000000iu/vialSchering Plough (Brinny) Co.
Intron A - Kit (pws+diluent) 5000000iu/vialSchering Plough (Brinny) Co.
Rebetron Ready To Use Solution (albumin(human)free) (6000000 Iu/ml and 200mg Capsules)Schering Plough Canada Inc
Rebetron Solution (albumin (human) Free) (18 Miu Multi-dose Pen / 200mg Capsules)Schering Plough Canada Inc
SaltsNot Available
Categories
UNII43K1W2T1M6
CAS number98530-12-2
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationFor the treatment of hairy cell leukemia, malignant melanoma, and AIDS-related Kaposi's sarcoma.
PharmacodynamicsUpregulates the expression of MHC I proteins, allowing for increased presentation of peptides derived from viral antigens. This enhances the activation of CD8+ T cells that are the precursors for cytotoxic T lymphocytes (CTLs) and makes the macrophage a better target for CTL-mediated killing. Interferon alpha also induce the synthesis of several key antiviral mediators, including 2'-5' oligoadenylate synthetase (2'-5' A synthetase) and protein kinase R.
Mechanism of actionInterferon alpha binds to type I interferon receptors (IFNAR1 and IFNAR2c) which upon dimerization activate two Jak (Janus kinase) tyrosine kinases (Jak1 and Tyk2). These transphosphorylate themselves and phosphorylate the receptors. The phosphorylated INFAR receptors then bind to Stat1 and Stat2 (signal transducers and activators of transcription)which dimerize and activate multiple (~100) immunomodulatory and antiviral proteins. Interferon alpha binds less stably to type I interferon receptors than interferon beta.
Related Articles
AbsorptionAbsorption is high (greater than 80%) when administered intramuscularly or subcutaneously.
Volume of distributionNot Available
Protein bindingNot Available
MetabolismNot Available
Route of eliminationNot Available
Half lifeThe elimination half-life following both intramuscular and subcutaneous injections was approximately 2 to 3 hours. The elimination half-life was approximately 2 hours following intravenous injection.
ClearanceNot Available
ToxicityThere is limited experience with overdosage. Postmarketing surveillance includes reports of patients receiving a single dose as great as 10 times the recommended dose. In general, the primary effects of an overdose are consistent with the effects seen with therapeutic doses of interferon alfa-2b. Hepatic enzyme abnormalities, renal failure, hemorrhage, and myocardial infarction have been reported with single administration overdoses and/or with longer durations of treatment than prescribed. Toxic effects after ingestion of interferon alfa-2b are not expected because interferons are poorly absorbed orally.
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Injection, solutionintralesional; intramuscular; subcutaneous19.2 ug/.5mL
Injection, solutionintramuscular; subcutaneous11.6 ug/.5mL
Kit
Kit; liquid; powder for solutionintralesional; intramuscular; intravenous; subcutaneous
Liquidsubcutaneous15000000 unit
Liquidsubcutaneous25000000 unit
Liquidsubcutaneous50000000 unit
Liquid; powder for solutionintralesional; intramuscular; intravenous; subcutaneous
Solutionintramuscular; intravenous; subcutaneous10000000 unit
Solutionintramuscular; intravenous; subcutaneous6000000 unit
Liquid; powder for solutionintralesional; intramuscular; subcutaneous
Liquidintralesional; intramuscular; subcutaneous5000000 unit
Liquidsubcutaneous10000000 unit
Liquidsubcutaneous3000000 unit
Liquidsubcutaneous5000000 unit
Kit; liquid; capsuleoral; subcutaneous
Prices
Unit descriptionCostUnit
Intron-A 10000000 unit/0.2ml Kit (each Box Contains One 6 Dose 1.5ml Pen)1110.84USD box
Intron a 10 million unit pen1068.12USD pen
Intron-A 5000000 unit/0.2ml Kit Box683.34USD box
Intron a 5 million unit/ml pen657.06USD pen
Intron a 3 million unit/ml pen394.21USD pen
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1341567 No2008-02-192025-02-19Canada
CA2201749 No1999-06-152015-10-10Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point61 °CBeldarrain, A. et al., Biochemistry 38:7865-7873 (1999)
hydrophobicity-0.339Not Available
isoelectric point5.99Not Available
References
Synthesis ReferenceNot Available
General References
  1. Radhakrishnan R, Walter LJ, Hruza A, Reichert P, Trotta PP, Nagabhushan TL, Walter MR: Zinc mediated dimer of human interferon-alpha 2b revealed by X-ray crystallography. Structure. 1996 Dec 15;4(12):1453-63. [PubMed:8994971 ]
External Links
ATC CodesL03AB05
AHFS Codes
  • 08:18.20
PDB Entries
FDA labelDownload (3.52 MB)
MSDSNot Available
Interactions
Drug Interactions
Drug
TelbivudineThe risk or severity of adverse effects can be increased when Interferon Alfa-2b, Recombinant is combined with Telbivudine.
Food Interactions
  • Avoid alcohol.

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
binder
General Function:
Type i interferon receptor activity
Specific Function:
Associates with IFNAR1 to form the type I interferon receptor. Receptor for interferons alpha and beta. Involved in IFN-mediated STAT1, STAT2 and STAT3 activation. Isoform 1 and isoform 2 are directly involved in signal transduction due to their association with the TYR kinase, JAK1. Isoform 3 is a potent inhibitor of type I IFN receptor activity.
Gene Name:
IFNAR2
Uniprot ID:
P48551
Molecular Weight:
57758.24 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
  3. Eid P, Tovey MG: Characterization of a domain of a human type I interferon receptor protein involved in ligand binding. J Interferon Cytokine Res. 1995 Mar;15(3):205-11. [PubMed:7584665 ]
  4. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
binder
General Function:
Type i interferon receptor activity
Specific Function:
Associates with IFNAR2 to form the type I interferon receptor. Receptor for interferons alpha and beta. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and IFNR alpha- and beta-subunits themselves. Can also transduce IFNB signals without the help of IFNAR2, and not activating the Jak-STAT pathway.
Gene Name:
IFNAR1
Uniprot ID:
P17181
Molecular Weight:
63524.81 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
  3. Khine AA, Lingwood CA: Functional significance of globotriaosyl ceramide in interferon-alpha(2)/type 1 interferon receptor-mediated antiviral activity. J Cell Physiol. 2000 Jan;182(1):97-108. [PubMed:10567921 ]
  4. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on March 22, 2016 21:10