| Version |
2.5 |
| Creation Date |
2005-06-13 13:24:05 |
| Update Date |
2009-02-19 16:03:43 |
| Primary Accession Number |
DB00634 |
| Secondary Accession Number |
|
| Name |
Sulfacetamide |
| Drug Type |
|
| Description |
An anti-infective agent that is used topically to treat skin infections and orally for urinary tract infections. [PubChem] |
| Synonyms |
Not Available |
| Brand Names |
- Acetocid
- Acetosulfamin
- Acetosulfamine
- Ak-Sulf
- Albamine
- Albucid
- Alesten
- Bleph-10
- Bleph-10 Liquifilm
- Cetamide
- Formosulfacetamide
- Gyne-Sulf
- I-Sulfacet
- Isopto Cetamide
- Isopto-Cetamide
- Klaron
- N'-Acetylsulfanilamide
- N-Acetylsulfanilamide
- N-Acetylsulfanilamine
- N-Sulfanilylacetamide
- N-Sulphanilylacetamide
- Oclucid
- Ocusulf-10
- Op-Sulfa 30
- Ophthacet
- Ophthel-S
- P-Aminobenzenesulfonacetamide
- P-Aminobenzenesulfonoacetamide
- Region
- Sebizon
- Sodium Sulamyd
- Sodium Sulfacetamide
- Steramide
- Steri-Units Sulfacetamide
- Sulamyd
- Sulf-10
- Sulf-15
- Sulfacel-15
- Sulfacet
- Sulfacetamide Sodium
- Sulfacetamide Sodium Anhydrous
- Sulfacetamide Sodium Usp
- Sulfacetimide
- Sulfacyl
- Sulfair
- Sulfair 10
- Sulfair 15
- Sulfair Forte
- Sulfair-15
- Sulfamide
- Sulfanilacetamide
- Sulfanilazetamid
- Sulfex
- Sulphacetamide
- Sulphacetamide Sodium
- Sulphasil
- Sulten-10
- Sultrin
- Trysul
- Urosulfon
- Urosulfone
|
| Brand Mixtures |
- Ak Cide Oph Soln (Prednisolone Acetate + Sulfacetamide Sodium)
- Blephamide Oph Ont (Prednisolone Acetate + Sulfacetamide Sodium)
- Blephamide Opht Suspension (Prednisolone Acetate + Sulfacetamide Sodium)
- Cocci Bol O Tab Jr (Calcium Carbonate + Charcoal Activated + Cobalt Gluconate + Copper Sulfate + Ferrous Gluconate + Sodium Arsanilate + Sulfabenzamide Sodium + Sulfacetamide Sodium + Sulfaquinoxaline + Tannic Acid)
- Cocci Bol-O-Tab (Calcium Carbonate + Charcoal Activated + Cobalt Gluconate + Copper Sulfate + Ferrous Gluconate + Sodium Arsanilate + Sulfabenzamide Sodium + Sulfacetamide Sodium + Sulfaquinoxaline + Tannic Acid)
- Dioptimyd Ointment (Prednisolone Acetate + Sulfacetamide Sodium)
- Dioptimyd Suspension (Prednisolone Acetate + Sulfacetamide Sodium)
- Medicocci-Jr (Arsenic (Sodium Arsanilate) + Calcium Carbonate + Charcoal Activated + Cobalt Gluconate + Copper Sulfate + Ferrous Gluconate + Sulfabenzamide Sodium + Sulfacetamide Sodium + Sulfaquinoxaline + Tannic Acid)
- Medicocci-Sr (Arsenic (Sodium Arsanilate) + Calcium Carbonate + Charcoal Activated + Cobalt Gluconate + Copper Sulfate + Ferrous Gluconate + Sulfabenzamide Sodium + Sulfacetamide Sodium + Sulfaquinoxaline + Tannic Acid)
- Metimyd Oph Sus (Prednisolone Acetate + Sulfacetamide Sodium)
- Neo Atropec 25 Tab (Aluminum Hydroxide + Atropine Methylnitrate + Kaolin + Neomycin Sulfate + Pectin + Sulfacetamide + Sulfaguanidine)
- Neo Atropec C Tab (Aluminum Hydroxide + Atropine Methylnitrate + Kaolin + Neomycin Sulfate + Pectin + Sulfacetamide + Sulfaguanidine)
- Neo Atropec Tab (Aluminum Hydroxide + Atropine Methylnitrate + Kaolin + Neomycin Sulfate + Pectin + Sulfacetamide + Sulfaguanidine)
- Sulfacet R Lotion (Sulfacetamide Sodium + Sulfur (Sulfur))
- Sulfacet-R Lotion (Sulfacetamide Sodium + Sulfur)
- Sultrin Triple Sulfa Crm (Sulfacetamide + Sulfanilylbenzamide + Sulfathiazole + Urea)
- Vasocidin Ophthalmic Solution (Prednisolone Sodium Phosphate + Sulfacetamide Sodium)
- Vasosulf Oph Soln (Phenylephrine Hydrochloride + Sulfacetamide Sodium)
|
| Chemical IUPAC Name |
N-(4-aminophenyl)sulfonylacetamide |
| Chemical Formula |
C8H10N2O3S |
| Chemical Structure |
 |
| CAS Registry Number |
144-80-9 |
| InChI Identifier |
InChI=1/C8H10N2O3S/c1-6(11)10-14(12,13)8-4-2-7(9)3-5-8/h2-5H,9H2,1H3,(H,10,11)/f/h10H |
| InChI Key |
SKIVFJLNDNKQPD-KZFATGLACW |
| KEGG Drug |
Not Available |
| KEGG Compound |
Not Available |
| PubChem Compound |
5320  |
| PubChem Substance |
152109  |
| ChEBI ID |
Not Available |
| PharmGKB ID |
PA451536  |
| HET ID |
Not Available |
| GenBank ID |
Not Available |
| Drug ID Number [DIN] |
00838934  |
| RxList Link |
http://www.rxlist.com/cgi/generic3/plexion.htm  |
| PDRhealth Link |
http://www.pdrhealth.com/drug_info/rxdrugprofiles/drugs/ava1674.shtml  |
| Wikipedia Link |
http://en.wikipedia.org/wiki/Sulfacetamide  |
| FDA Label |
|
| Material Safety Data Sheet (MSDS) |
|
| Synthesis Reference |
Not Available |
| Average Molecular Weight |
214.2420 |
| Monoisotopic Molecular Weight |
214.0412 |
| State |
Solid |
| Melting Point |
183 oC |
| Experimental Water Solubility |
1.25E+004 mg/L
Source: PhysProp
|
| Predicted Water Solubility |
4.21e+00 mg/mL
Calculated using ALOGPS
|
| Experimental LogP/Hydrophobicity |
-0.6
Source: PhysProp
|
| Predicted LogP |
0.15
Calculated using ALOGPS
|
| Experimental LogS |
-1.23 [ADME Research, USCD] |
| Predicted LogS |
-1.71
Calculated using ALOGPS
|
| Experimental Caco2 Permeability |
Not Available |
| pKa/Isoelectric Point |
Not Available |
| Mass Spectrum |
Not Available
|
| MOL File |
Show | Download  |
| SDF File |
Show | Download  |
| PDB File |
Show | Download  |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
1K0G  |
| Experimental PDB File |
Show |
| Experimental PDB Structure |
|
| Isomeric SMILES |
CC(=O)NS(=O)(=O)C1=CC=C(N)C=C1 |
| Canonical SMILES |
CC(=O)NS(=O)(=O)C1=CC=C(N)C=C1 |
| Drug Category |
- Anti-Bacterial Agents
- Anti-Infective Agents, Local
- Anti-Infective Agents, Urinary
- Sulfonamides
|
| ATC Codes |
|
| AHFS Codes |
|
| Indication |
For the treatment of bacterial vaginitis, keratitis, acute conjunctivitis, and blepharitis. |
| Pharmacology |
Sulfacetamide is a sulfonamide antibiotic. The sulfonamides are synthetic bacteriostatic antibiotics with a wide spectrum against most gram-positive and many gram-negative organisms. However, many strains of an individual species may be resistant. Sulfonamides inhibit multiplication of bacteria by acting as competitive inhibitors of p-aminobenzoic acid in the folic acid metabolism cycle. Bacterial sensitivity is the same for the various sulfonamides, and resistance to one sulfonamide indicates resistance to all. Most sulfonamides are readily absorbed orally. However, parenteral administration is difficult, since the soluble sulfonamide salts are highly alkaline and irritating to the tissues. The sulfonamides are widely distributed throughout all tissues. High levels are achieved in pleural, peritoneal, synovial, and ocular fluids. Although these drugs are no longer used to treat meningitis, CSF levels are high in meningeal infections. Their antibacterial action is inhibited by pus. |
| Mechanism of Action |
Sulfacetamide is a competitive inhibitor of bacterial para-aminobenzoic acid (PABA), an essential component for bacterial growth (according to the Woods-Fildes theory). The inhibited reaction is necessary in these organisms for the synthesis of folic acid. |
| Absorption |
Not Available |
| Toxicity |
Oral LD50 Mouse : 16500 mg/kg. Side effects include moderate to severe erythema (redness) and moderate edema (raised kin), nausea, vomiting, headache, dizziness, and tiredness. Higher exposure causes unconsciousness. |
| Protein Binding |
Not Available |
| Biotransformation |
Not Available |
| Half Life |
7-12.8 hours |
| Dosage Forms |
| Form |
Route |
| Liquid |
Ophthalmic |
| Ointment |
Ophthalmic |
| Solution / drops |
Ophthalmic |
|
| Patient Information |
Show  |
| Contraindications |
Show  |
| Interactions |
Show  |
| Drug Interactions |
Not Available
|
| Food Interactions |
Not Available
|
| Pathways |
Not Available
|
| General References |
- Del Rosso JQ: Evaluating the role of topical therapies in the management of rosacea: focus on combination sodium sulfacetamide and sulfur formulations. Cutis. 2004 Jan;73(1 Suppl):29-33. [PubMed
]
- Hull CA, Johnson SM: A double-blind comparative study of sodium sulfacetamide lotion 10% versus selenium sulfide lotion 2.5% in the treatment of pityriasis (tinea) versicolor. Cutis. 2004 Jun;73(6):425-9. [PubMed
]
- Roth HW, Leimbeck R, Sonnenschein B, Anger CB, Weber S: [The effective antibacterial spectrum of sulfacetamide] Klin Monatsbl Augenheilkd. 1992 Mar;200(3):182-6. [PubMed
]
- Drugs.com

- Wikipedia

- RxList

- PDRhealth

|
| Organisms Affected |
- Enteric bacteria and other eubacteria
|
| Targets |
- Para-aminobenzoate synthase component 1
|
|
Drug Target 1
[top]
|
| Target 1 ID |
658 |
| Target 1 Name |
Para-aminobenzoate synthase component 1 |
| Target 1 Synonyms |
- ADC synthase
- EC 6.3.5.8
- Para- aminobenzoate synthase component I
|
| Target 1 Gene Name |
pabB |
| Target 1 Protein Sequence |
>Para-aminobenzoate synthase component 1
MKTLSPAVITLLWRQDAAEFYFSRLSHLPWAMLLHSGYADHPYSRFDIVVAEPICTLTTF
GKETVVSESEKRTTTTDDPLQVLQQVLDRADIRPTHNEDLPFQGGALGLFGYDLGRRFES
LPEIAEQDIVLPDMAVGIYDWALIVDHQRHTVSLLSHNDVNARRAWLESQQFSPQEDFTL
TSDWQSNMTREQYGEKFRQVQEYLHSGDCYQVNLAQRFHATYSGDEWQAFLQLNQANRAP
FSAFLRLEQGAILSLSPERFILCDNSEIQTRPIKGTLPRLPDPQEDSKQAVKLANSAKDR
AENLMIVDLMRNDIGRVAVAGSVKVPELFVVEPFPAVHHLVSTITAQLPEQLHASDLLRA
AFPGGSITGAPKVRAMEIIDELEPQRRNAWCGSIGYLSFCGNMDTSITIRTLTAINGQIF
CSAGGGIVADSQEEAEYQETFDKVNRILKQLEK
|
| Target 1 Number of Residues |
460 |
| Target 1 Molecular Weight |
50970 |
| Target 1 Theoretical pI |
4.88 |
| Target 1 GO Classification |
|
Function
|
catalytic activity
lyase activity
carbon-carbon lyase activity
oxo-acid-lyase activity |
|
Process
|
cellular metabolism
aromatic compound metabolism
folic acid and derivative metabolism
folic acid and derivative biosynthesis
physiological process
metabolism
biosynthesis |
|
Component
|
| Not Available |
|
| Target 1 General Function |
Amino acid transport and metabolism |
| Target 1 Specific Function |
Catalyzes the biosynthesis of 4-amino-4-deoxychorismate (ADC) from chorismate and glutamine |
| Target 1 Pathways |
| Name |
SMPDB Link |
KEGG Link |
| Folate biosynthesis |
|
map00790  |
|
| Target 1 Reactions |
- chorismate + L-glutamine = 4-amino-4-deoxychorismate + L-glutamate
|
| Target 1 Pfam Domain Function |
|
| Target 1 Signals |
|
| Target 1 Transmembrane Regions |
|
| Target 1 Essentiality |
Essential |
| Target 1 GenBank ID Protein |
147058  |
| Target 1 UniProtKB/Swiss-Prot ID |
P05041  |
| Target 1 UniProtKB/Swiss-Prot Entry Name |
PABB_ECOLI  |
| Target 1 PDB ID |
1K0G  |
| Target 1 PDB File |
Show |
| Target 1 3D Structure |
|
| Target 1 Cellular Location |
Not Available |
| Target 1 Gene Sequence |
>1362 bp
ATGAAGACGTTATCTCCCGCTGTGATTACTTTACTCTGGCGTCAGGACGCCGCTGAATTT
TATTTCTCCCGCTTAAGCCACCTGCCGTGGGCGATGCTTTTACACTCCGGCTATGCCGAT
CATCCGTATAGCCGCTTTGATATTGTGGTCGCCGAGCCGATTTGCACTTTAACCACTTTC
GGTAAAGAAACCGTTGTTAGTGAAAGCGAAAAACGCACAACGACCACTGATGACCCGCTA
CAGGTGCTCCAGCAGGTGCTGGATCGCGCAGACATTCGCCCAACGCATAACGAAGATTTG
CCATTTCAGGGCGGCGCACTGGGGTTGTTTGGCTACGATCTGGGCCGCCGTTTTGAGTCA
CTGCCAGAAATTGCGGAACAAGATATCGTTCTGCCGGATATGGCAGTGGGTATCTACGAT
TGGGCGCTCATTGTCGACCACCAGCGTCATACAGTTTCTTTGCTGAGTCATAATGATGTC
AATGCCCGTCGGGCCTGGCTGGAAAGCCAGCAATTCTCGCCGCAGGAAGATTTCACGCTC
ACTTCCGACTGGCAATCCAATATGACCCGCGAGCAGTACGGCGAAAAATTTCGCCAGGTA
CAGGAATATCTGCACAGCGGTGATTGCTATCAGGTGAATCTCGCCCAACGTTTTCATGCG
ACCTATTCTGGCGATGAATGGCAGGCATTCCTTCAGCTTAATCAGGCCAACCGCGCGCCA
TTTAGCGCTTTTTTACGTCTTGAACAGGGTGCAATTTTAAGCCTTTCGCCAGAGCGGTTT
ATTCTTTGTGATAATAGTGAAATCCAGACCCGCCCGATTAAAGGCACGCTACCACGCCTG
CCCGATCCTCAGGAAGATAGCAAACAAGCAGTAAAACTGGCGAACTCAGCGAAAGATCGT
GCCGAAAATCTGATGATTGTCGATTTAATGCGTAATGATATCGGTCGTGTTGCCGTAGCA
GGTTCGGTAAAAGTACCAGAGCTGTTCGTGGTGGAACCCTTCCCTGCCGTGCATCATCTG
GTCAGCACCATAACGGCGCAACTACCAGAACAGTTACACGCCAGCGATCTGCTGCGCGCA
GCTTTTCCTGGTGGCTCAATAACCGGGGCTCCGAAAGTACGGGCTATGGAAATTATCGAC
GAACTGGAACCGCAGCGACGCAATGCCTGGTGCGGCAGCATTGGCTATTTGAGCTTTTGC
GGCAACATGGATACCAGTATTACTATCCGCACGCTGACTGCCATTAACGGACAAATTTTC
TGCTCTGCGGGCGGTGGAATTGTCGCCGATAGCCAGGAAGAAGCGGAATATCAGGAAACT
TTTGATAAAGTTAATCGTATCCTGAAGCAACTGGAGAAGTAA
|
| Target 1 GenBank Gene ID |
|
| Target 1 GeneCard ID |
Not Available |
| Target 1 GenAtlas ID |
Not Available |
| Target 1 HGNC ID |
Not Available |
| Target 1 Chromosome Location |
Not Available |
| Target 1 Locus |
Not Available |
| Target 1 SNPs |
SNPJam Report  |
| Target 1 General References |
- Ye QZ, Liu J, Walsh CT: p-Aminobenzoate synthesis in Escherichia coli: purification and characterization of PabB as aminodeoxychorismate synthase and enzyme X as aminodeoxychorismate lyase. Proc Natl Acad Sci U S A. 1990 Dec;87(23):9391-5. [PubMed
]
- Goncharoff P, Nichols BP: Nucleotide sequence of Escherichia coli pabB indicates a common evolutionary origin of p-aminobenzoate synthetase and anthranilate synthetase. J Bacteriol. 1984 Jul;159(1):57-62. [PubMed
]
- Viswanathan VK, Green JM, Nichols BP: Kinetic characterization of 4-amino 4-deoxychorismate synthase from Escherichia coli. J Bacteriol. 1995 Oct;177(20):5918-23. [PubMed
]
- Guttman DS, Dykhuizen DE: Detecting selective sweeps in naturally occurring Escherichia coli. Genetics. 1994 Dec;138(4):993-1003. [PubMed
]
- Itoh T, Aiba H, Baba T, Hayashi K, Inada T, Isono K, Kasai H, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Seki Y, Horiuchi T, et al.: A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map. DNA Res. 1996 Dec 31;3(6):379-92. [PubMed
]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-74. [PubMed
]
|
| Target 1 Drug References |
- Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed
]
- Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed
]
|