| Version |
2.5 |
| Creation Date |
2005-06-13 13:24:05 |
| Update Date |
2009-04-16 16:48:02 |
| Primary Accession Number |
DB00835 |
| Secondary Accession Number |
|
| Name |
Brompheniramine |
| Drug Type |
|
| Description |
Histamine H1 antagonist used in treatment of allergies, rhinitis, and urticaria. [PubChem] |
| Synonyms |
- Brompheniramine Maleate
|
| Brand Names |
- Bromfed
- Bromfenex
- Dimetane
- Veltane
|
| Brand Mixtures |
- Cold & Allergy (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Cold & Allergy Relief - Liq (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Cold Relief (Brompheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Cold Relief Dm (Brompheniramine Maleate + Dextromethorphan Hydrobromide + Phenylpropanolamine Hydrochloride)
- Cough, Cold & Allergy Relief (Brompheniramine Maleate + Dextromethorphan Hydrobromide + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Decongestant Antihistaminic Syrup (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Dimetane Expectorant Liq (Brompheniramine Maleate + Guaifenesin + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Dimetane Expectorant-C Syr (Brompheniramine Maleate + Codeine Phosphate + Guaifenesin + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Dimetane Expectorant-C Syrup (Brompheniramine Maleate + Codeine Phosphate + Guaifenesin + Phenylephrine Hydrochloride)
- Dimetane Expectorant-Dc Syr (Brompheniramine Maleate + Guaifenesin + Hydrocodone Bitartrate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Dimetane Expectorant-Dc Syrup (Brompheniramine Maleate + Guaifenesin + Hydrocodone Bitartrate + Phenylephrine Hydrochloride)
- Dimetapp (Brompheniramine Maleate + Phenylephrine Hydrochloride)
- Dimetapp Chewable Tablets (Brompheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Dimetapp Children's Cold & Allergy Tablets (Brompheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Dimetapp Children's Cold & Fever (Acetaminophen + Brompheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Dimetapp Clear (Brompheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Dimetapp Cough & Cold Liqui-Gels - Cap (Brompheniramine Maleate + Dextromethorphan Hydrobromide + Phenylpropanolamine Hydrochloride)
- Dimetapp Cough, Cold & Flu (Acetaminophen + Brompheniramine Maleate + Dextromethorphan Hydrobromide + Phenylpropanolamine Hydrochloride)
- Dimetapp Dm Cough & Cold Liquid (Brompheniramine Maleate + Dextromethorphan Hydrobromide + Phenylephrine Hydrochloride)
- Dimetapp Dm Elixir (Brompheniramine Maleate + Dextromethorphan Hydrobromide + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Dimetapp Dm Tab (Brompheniramine Maleate + Dextromethorphan Hydrobromide + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Dimetapp Elixir (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Dimetapp Extentabs (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Dimetapp Extra Strength (Brompheniramine Maleate + Phenylephrine Hydrochloride)
- Dimetapp Extra Strength Dm Cough & Cold (Brompheniramine Maleate + Dextromethorphan Hydrobromide + Phenylephrine Hydrochloride)
- Dimetapp Liqui-Gels Cap (Brompheniramine Maleate + Phenylpropanolamine Hydrochloride)
- Dimetapp Oral Infant Cold Drops (Brompheniramine Maleate + Phenylephrine Hydrochloride)
- Dimetapp Oral Infant Cold and Fever Drops (Acetaminophen + Brompheniramine Maleate + Phenylephrine Hydrochloride)
- Dimetapp Oral Infant Drops (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Dimetapp Tab (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Dimetapp-C Syr (Brompheniramine Maleate + Codeine Phosphate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Dimetapp-C Syrup (Brompheniramine Maleate + Codeine Phosphate + Phenylephrine Hydrochloride)
- Pharmetapp Elixir (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
- Tantapp Elixir (Brompheniramine Maleate + Phenylephrine Hydrochloride + Phenylpropanolamine Hydrochloride)
|
| Chemical IUPAC Name |
3-(4-bromophenyl)-N,N-dimethyl-3-pyridin-2-ylpropan-1-amine |
| Chemical Formula |
C16H19BrN2 |
| Chemical Structure |
 |
| CAS Registry Number |
86-22-6 |
| InChI Identifier |
InChI=1/C16H19BrN2/c1-19(2)12-10-15(16-5-3-4-11-18-16)13-6-8-14(17)9-7-13/h3-9,11,15H,10,12H2,1-2H3 |
| InChI Key |
ZDIGNSYAACHWNL-UHFFFAOYAT |
| KEGG Drug |
Not Available |
| KEGG Compound |
C06857  |
| PubChem Compound |
6834  |
| PubChem Substance |
9075  |
| ChEBI ID |
Not Available |
| PharmGKB ID |
PA448675  |
| HET ID |
Not Available |
| GenBank ID |
Not Available |
| Drug ID Number [DIN] |
02244079  |
| RxList Link |
Not Available |
| PDRhealth Link |
Not Available |
| Wikipedia Link |
http://en.wikipedia.org/wiki/Brompheniramine  |
| FDA Label |
Not Available |
| Material Safety Data Sheet (MSDS) |
|
| Synthesis Reference |
Not Available |
| Average Molecular Weight |
319.2390 |
| Monoisotopic Molecular Weight |
318.0732 |
| State |
Liquid |
| Melting Point |
< 25 oC |
| Experimental Water Solubility |
Freely soluble (maleate salt)
Source: PhysProp
|
| Predicted Water Solubility |
1.27e-02 mg/mL
Calculated using ALOGPS
|
| Experimental LogP/Hydrophobicity |
3.4
Source: PhysProp
|
| Predicted LogP |
3.63
Calculated using ALOGPS
|
| Experimental LogS |
Not Available |
| Predicted LogS |
-4.40
Calculated using ALOGPS
|
| Experimental Caco2 Permeability |
Not Available |
| pKa/Isoelectric Point |
Not Available |
| Mass Spectrum |
Not Available
|
| MOL File |
Show | Download  |
| SDF File |
Show | Download  |
| PDB File |
Show | Download  |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
Not Available |
| Isomeric SMILES |
CN(C)CC[C@H](C1=CC=C(Br)C=C1)C1=CC=CC=N1 |
| Canonical SMILES |
CN(C)CCC(C1=CC=C(Br)C=C1)C1=CC=CC=N1 |
| Drug Category |
- Anti-Allergic Agents
- Histamine H1 Antagonists
|
| ATC Codes |
|
| AHFS Codes |
Not Available |
| Indication |
For the treatment of the symptoms of the common cold and allergic rhinitis, such as runny nose, itchy eyes, watery eyes, and sneezing. |
| Pharmacology |
Brompheniramine is an antihistaminergic medication of the propylamine class. It is a first-generation antihistamine. In allergic reactions an allergen interacts with and cross-links surface IgE antibodies on mast cells and basophils. Once the mast cell-antibody-antigen complex is formed, a complex series of events occurs that eventually leads to cell-degranulation and the release of histamine (and other chemical mediators) from the mast cell or basophil. Once released, histamine can react with local or widespread tissues through histamine receptors. Histamine, acting on H1-receptors, produces pruritis, vasodilatation, hypotension, flushing, headache, tachycardia, and bronchoconstriction. Histamine also increases vascular permeability and potentiates pain. Brompheniramine is a histamine H1 antagonist (or more correctly, an inverse histamine agonist) of the alkylamine class. It provides effective, temporary relief of sneezing, watery and itchy eyes, and runny nose due to hay fever and other upper respiratory allergies. |
| Mechanism of Action |
Brompheniramine works by acting as an antagonist of the H1 histamine receptors. It also functions as a moderately effective anticholingeric agent, likely an antimuscarinic agent similar to other common antihistamines such as diphenhydramine. Its effects on the cholinergic system may include side-effects such as drowsiness, sedation, dry mouth, dry throat, blurred vision, and increased heart rate. |
| Absorption |
Antihistamines are well absorbed from the gastrointestinal tract after oral administration. |
| Toxicity |
Oral, rat: LD50 = 318 mg/kg. Signs of overdose include fast or irregular heartbeat, mental or mood changes, tightness in the chest, and unusual tiredness or weakness. |
| Protein Binding |
Not Available |
| Biotransformation |
Hepatic (cytochrome P-450 system), some renal. |
| Half Life |
Not Available |
| Dosage Forms |
Not Available
|
| Patient Information |
Show  |
| Contraindications |
Show  |
| Interactions |
Show  |
| Drug Interactions |
| Drug |
Interaction |
| Donepezil |
Possible antagonism of action |
| Galantamine |
Possible antagonism of action |
| Rivastigmine |
Possible antagonism of action |
|
| Food Interactions |
- Avoid alcohol.
- Take with food.
|
| Pathways |
Not Available
|
| General References |
- Drugs.com

- Wikipedia

|
| Organisms Affected |
|
| Targets |
- Histamine H1 receptor
|
|
Drug Target 1
[top]
|
| Target 1 ID |
492 |
| Target 1 Name |
Histamine H1 receptor |
| Target 1 Synonyms |
Not Available |
| Target 1 Gene Name |
HRH1 |
| Target 1 Protein Sequence |
>Histamine H1 receptor
MSLPNSSCLLEDKMCEGNKTTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHT
VGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFI
LCIDRYRSVQQPLRYLKYRTKTRASATILGAWFLSFLWVIPILGWNHFMQQTSVRREDKC
ETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCQHRELINRSLPSFSEIKLR
PENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKL
YCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSR
TDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFI
MAAFILCWIPYFIFFMVIAFCKNCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFK
RILHIRS
|
| Target 1 Number of Residues |
495 |
| Target 1 Molecular Weight |
55785 |
| Target 1 Theoretical pI |
9.58 |
| Target 1 GO Classification |
|
Function
|
amine receptor activity
histamine receptor activity
signal transducer activity
receptor activity
transmembrane receptor activity
G-protein coupled receptor activity
rhodopsin-like receptor activity |
|
Process
|
cellular process
cell communication
signal transduction
cell surface receptor linked signal transduction
G-protein coupled receptor protein signaling pathway |
|
Component
|
cell
membrane
intrinsic to membrane
integral to membrane |
|
| Target 1 General Function |
Involved in rhodopsin-like receptor activity |
| Target 1 Specific Function |
In peripheral tissues, the H1 subclass of histamine receptors mediates the contraction of smooth muscles, increase in capillary permeability due to contraction of terminal venules, and catecholamine release from adrenal medulla, as well as mediating neurotransmission in the central nervous system |
| Target 1 Pathways |
Not Available
|
| Target 1 Reactions |
Not Available |
| Target 1 Pfam Domain Function |
|
| Target 1 Signals |
|
| Target 1 Transmembrane Regions |
- 30-49
- 64-83
- 102-123
- 146-165
- 190-210
- 419-438
- 451-470
|
| Target 1 Essentiality |
Non-Essential |
| Target 1 GenBank ID Protein |
510296  |
| Target 1 UniProtKB/Swiss-Prot ID |
P35367  |
| Target 1 UniProtKB/Swiss-Prot Entry Name |
HRH1_HUMAN  |
| Target 1 PDB ID |
Not Available |
| Target 1 Cellular Location |
- Membrane
- multi-pass membrane protein
|
| Target 1 Gene Sequence |
>1464 bp
ATGAGCCTCCCCAATTCCTCCTGCCTCTTAGAAGACAAGATGTGTGAGGGCAACAAGACC
ACTATGGCCAGCCCCCAGCTGATGCCCCTGGTGGTGGTCCTGAGCACTATCTGCTTGGTC
ACAGTAGGGCTCAACCTGCTGGTGCTGTATGCCGTACGGAGTGAGCGGAAGCTCCACACT
GTGGGGAACCTGTACATCGTCAGCCTCTCGGTGGCGGACTTGATCGTGGGTGCCGTCGTC
ATGCCTATGAACATCCTCTACCTGCTCATGTCCAAGTGGTCACTGGGCCGTCCTCTCTGC
CTCTTTTGGCTTTCCATGGACTATGTGGCCAGCACAGCGTCCATTTTCAGTGTCTTCATC
CTGTGCATTGATCGCTACCGCTCTGTCCAGCAGCCCCTCAGGTACCTTAAGTATCGTACC
AAGACCCGAGCCTCGGCCACCATTCTGGGGGCCTGGTTTCTCTCTTTTCTGTGGGTTATT
CCCATTCTAGGCTGGAATCACTTCATGCAGCAGACCTCGGTGCGCCGAGAGGACAAGTGT
GAGACAGACTTCTATGATGTCACCTGGTTCAAGGTCATGACTGCCATCATCAACTTCTAC
CTGCCCACCTTGCTCATGCTCTGGTTCTATGCCAAGATCTACAAGGCCGTACGACAACAC
TGCCAGCACCGGGAGCTCATCAATAGGTCCCTCCCTTCCTTCTCAGAAATTAAGCTGAGG
CCAGAGAACCCCAAGGGGGATGCCAAGAAACCAGGGAAGGAGTCTCCCTGGGAGGTTCTG
AAAAGGAAGCCAAAAGATGCTGGTGGTGGATCTGTCTTGAAGTCACCATCCCAAACCCCC
AAGGAGATGAAATCCCCAGTTGTCTTCAGCCAAGAGGATGATAGAGAAGTAGACAAACTC
TACTGCTTTCCACTTGATATTGTGCACATGCAGGCTGCGGCAGAGGGGAGTAGCAGGGAC
TATGTAGCCGTCAACCGGAGCCATGGCCAGCTCAAGACAGATGAGCAGGGCCTGAACACA
CATGGGGCCAGCGAGATATCAGAGGATCAGATGTTAGGTGATAGCCAATCCTTCTCTCGA
ACGGACTCAGATACCACCACAGAGACAGCACCAGGCAAAGGCAAATTGAGGAGTGGGTCT
AACACAGGCCTGGATTACATCAAGTTTACTTGGAAGAGGCTCCGCTCGCATTCAAGACAG
TATGTATCTGGGTTGCACATGAACCGCGAAAGGAAGGCCGCCAAACAGTTGGGTTTTATC
ATGGCAGCCTTCATCCTCTGCTGGATCCCTTATTTCATCTTCTTCATGGTCATTGCCTTC
TGCAAGAACTGTTGCAATGAACATTTGCACATGTTCACCATCTGGCTGGGCTACATCAAC
TCCACACTGAACCCCCTCATCTACCCCTTGTGCAATGAGAACTTCAAGAAGACATTCAAG
AGAATTCTGCATATTCGCTCCTAA
|
| Target 1 GenBank Gene ID |
|
| Target 1 GeneCard ID |
HRH1  |
| Target 1 GenAtlas ID |
HRH1  |
| Target 1 HGNC ID |
HGNC:5182  |
| Target 1 Chromosome Location |
3 |
| Target 1 Locus |
3p25 |
| Target 1 SNPs |
SNPJam Report  |
| Target 1 General References |
- Fukui H, Fujimoto K, Mizuguchi H, Sakamoto K, Horio Y, Takai S, Yamada K, Ito S: Molecular cloning of the human histamine H1 receptor gene. Biochem Biophys Res Commun. 1994 Jun 15;201(2):894-901. [PubMed
]
- De Backer MD, Gommeren W, Moereels H, Nobels G, Van Gompel P, Leysen JE, Luyten WH: Genomic cloning, heterologous expression and pharmacological characterization of a human histamine H1 receptor. Biochem Biophys Res Commun. 1993 Dec 30;197(3):1601-8. [PubMed
]
|
| Target 1 Drug References |
- Bokesoy TA, Onaran HO: Atypical Schild plots with histamine H1 receptor agonists and antagonists in the rabbit aorta. Eur J Pharmacol. 1991 May 2;197(1):49-56. [PubMed
]
- Onaran HO, Bokesoy TA: Kinetics of antagonism at histamine-H1 receptors in isolated rabbit arteries. Naunyn Schmiedebergs Arch Pharmacol. 1990 Apr;341(4):316-23. [PubMed
]
- Yanni JM, Stephens DJ, Parnell DW, Spellman JM: Preclinical efficacy of emedastine, a potent, selective histamine H1 antagonist for topical ocular use. J Ocul Pharmacol. 1994 Winter;10(4):665-75. [PubMed
]
|