Drugbank Logo

Showing drug card for Pseudoephedrine (DB00852)

Legend: drug field target field enzyme field

for drugs
Version 2.5
Creation Date 2005-06-13 13:24:05
Update Date 2009-04-16 16:48:04
Primary Accession Number DB00852
Secondary Accession Number
  • APRD00634
Name Pseudoephedrine
Drug Type
  • Approved
  • Small Molecule
Description An alpha- and beta-adrenergic agonist that may also enhance release of norepinephrine. It has been used in the treatment of several disorders including asthma, heart failure, rhinitis, and urinary incontinence, and for its central nervous system stimulatory effects in the treatment of narcolepsy and depression. It has become less extensively used with the advent of more selective agonists. [PubChem]
Synonyms Not Available
Brand Names
  1. Afrin
  2. Afrinol
  3. Balminil Decongestant Syrup
  4. Benylin Decongestant
  5. Besan
  6. Cenafed
  7. Chlor-Trimeton
  8. D-Isoephedrine
  9. D-Pseudoephedrine
  10. Decofed
  11. Dimetapp Decongestant
  12. Dimetapp Decongestant Pediatric Drops
  13. Drixoral N.D.
  14. Drixoral Nasal Decongestant
  15. Efidac 24 Pseudoephedrine Hcl
  16. Efidac/24
  17. Eltor 120
  18. Genaphed
  19. Isoephedrine
  20. Maxenal
  21. Myfedrine
  22. Novafed
  23. Pedia Care
  24. Pseudo
  25. Pseudo 60's
  26. Pseudo-12
  27. Pseudoefedrina [INN-Spanish]
  28. Pseudoephedrine D-Form
  29. Pseudoephedrine Ephedrine
  30. Pseudoephedrine Hcl
  31. Pseudoephedrinum [INN-Latin]
  32. Psi-Ephedrin
  33. Psi-Ephedrine
  34. Robidrine
  35. Sudafed
  36. Sudafed 12 Hour
  37. Sudafed Decongestant
  38. Sudafed Decongestant 12 Hour
  39. Sudafed Decongestant Extra Strength
  40. Trans-Ephedrine
  41. Triaminic AM Decongestant Formula
  42. Triaminic Infant Oral Decongestant Drops
Brand Mixtures
  1. Actifed DM Syrup (Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride + Triprolidine Hydrochloride)
  2. Actifed DM Tablets (Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride + Triprolidine Hydrochloride)
  3. Actifed Plus Caplet (Acetaminophen + Pseudoephedrine Hydrochloride + Triprolidine Hydrochloride)
  4. Actifed Syrup (Pseudoephedrine Hydrochloride + Triprolidine Hydrochloride)
  5. Actifed Tablets (Pseudoephedrine Hydrochloride + Triprolidine Hydrochloride)
  6. Allergy Sinus Medication - Caplet (Acetaminophen + Chlorpheniramine Maleate + Pseudoephedrine Hydrochloride)
  7. Benadryl Decongestant Tablets (Diphenhydramine Hydrochloride + Pseudoephedrine Hydrochloride)
  8. Benylin 4 Flu - Syrup (Acetaminophen + Dextromethorphan Hydrobromide + Guaifenesin + Pseudoephedrine Hydrochloride)
  9. Benylin Codeine 3.3mg de Syr (Codeine Phosphate + Guaifenesin + Pseudoephedrine Hydrochloride)
  10. Bronchodex Pediatrique (Dextromethorphan Hydrobromide + Guaifenesin + Pheniramine Maleate + Pseudoephedrine Hydrochloride)
  11. Calmylin #2 Syr (Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  12. Calmylin #3 Syr (Dextromethorphan Hydrobromide + Guaifenesin + Pseudoephedrine Hydrochloride)
  13. Calmylin Codeine D-E Syr (Codeine Phosphate + Guaifenesin + Pseudoephedrine Hydrochloride)
  14. Calmylin Cough and Flu Liq (Acetaminophen + Dextromethorphan Hydrobromide + Guaifenesin + Pseudoephedrine Hydrochloride)
  15. Calmylin Pediatric Syrup (Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  16. Centracol Pediatrique - Syr (Dextromethorphan Hydrobromide + Guaifenesin + Pheniramine Maleate + Pseudoephedrine Hydrochloride)
  17. Children's Tussin Cough Medicine DM Antitussive Decongestant (Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  18. Children's Tylenol Allergy - D Chewable Tablets (Acetaminophen + Diphenhydramine Hydrochloride + Pseudoephedrine Hydrochloride)
  19. Children's Tylenol Allergy-D Suspension (Acetaminophen + Diphenhydramine Hydrochloride + Pseudoephedrine Hydrochloride)
  20. Children's Tylenol Cold Liquid (Acetaminophen + Chlorpheniramine Maleate + Pseudoephedrine Hydrochloride)
  21. Children's Tylenol Cold Liquid with DM (Acetaminophen + Chlorpheniramine Maleate + Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  22. Children's Tylenol Sinus Chewable Tablet (Acetaminophen + Pseudoephedrine Hydrochloride)
  23. Clarinex-D 12 Hour Extended Release Tablets (desloratadine + pseudoephedrine)
  24. Claritin Allergy + Sinus Extra Strength (Loratadine + Pseudoephedrine Sulfate)
  25. Cold/Flu Relief (Acetaminophen + Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  26. Contac Day & Night Sinus/Allergy Caplet (Acetaminophen + Diphenhydramine Hydrochloride + Pseudoephedrine Hydrochloride)
  27. Contac-C Ext.Stren.Night Time Cough,Cold&Flu (Acetaminophen + Diphenhydramine Hydrochloride + Pseudoephedrine Hydrochloride)
  28. Cotrifed (Codeine Phosphate + Pseudoephedrine Hydrochloride + Triprolidine Hydrochloride)
  29. Cough Syr W.Cod. Pseudoephed.Hcl Guaifenesin (Codeine Phosphate + Guaifenesin + Pseudoephedrine Hydrochloride)
  30. Cough Syrup DM Decongestant (Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  31. Cough Syrup DM Decongestant Expectorant (Dextromethorphan Hydrobromide + Guaifenesin + Pseudoephedrine Hydrochloride)
  32. Cough Syrup DM Decongestant for Children (Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  33. Cough Syrup DM-D-E (Dextromethorphan Hydrobromide + Guaifenesin + Pseudoephedrine Hydrochloride)
  34. Cough and Flu Syrup (Acetaminophen + Dextromethorphan Hydrobromide + Guaifenesin + Pseudoephedrine Hydrochloride)
  35. DM Cough Syrup Decongestant (Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  36. DM Plus Decongestant Cough Syrup (Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  37. DM Plus Decongestant Plus Expector.Ex.St.Syr (Dextromethorphan Hydrobromide + Guaifenesin + Pseudoephedrine Hydrochloride)
  38. DM Plus Decongestant Plus Expectorant Cough Syrup (Dextromethorphan Hydrobromide + Guaifenesin + Pseudoephedrine Hydrochloride)
  39. DM-D-Expectorant Cough and Cold Syrup (Dextromethorphan Hydrobromide + Guaifenesin + Pseudoephedrine Hydrochloride)
  40. Demdec Syr (Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  41. Dimetapp Children's Cough and Cold Liquid (Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  42. Dimetapp Cold and Sinus Caplets (Ibuprofen + Pseudoephedrine Hydrochloride)
  43. Dristan Sinus Caplets (Ibuprofen + Pseudoephedrine Hydrochloride)
  44. Extra Strength Allergy Plus Sinus Relief (Acetaminophen + Chlorpheniramine Maleate + Pseudoephedrine Hydrochloride)
  45. Extra Strength Allergy Sinus Medication (Acetaminophen + Chlorpheniramine Maleate + Pseudoephedrine Hydrochloride)
  46. Extra Strength Cold Medication Daytime Rlf (Acetaminophen + Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  47. Extra Strength Daytime Cold Relief-Caplet (Acetaminophen + Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  48. Extra Strength Nighttime Cold Relief-Caplet (Acetaminophen + Chlorpheniramine Maleate + Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  49. Extra Strength Sinus Medication-Caplet (Acetaminophen + Pseudoephedrine Hydrochloride)
  50. Extra Strength Sinus Relief-Caplet (Acetaminophen + Pseudoephedrine Hydrochloride)
  51. Extra Strength Tylenol Cold and Flu Powder (Acetaminophen + Chlorpheniramine Maleate + Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  52. Extra Strength Tylenol Sinus Nighttime Caplet (Acetaminophen + Doxylamine Succinate + Pseudoephedrine Hydrochloride)
  53. Ibuprofen and Pseudoephedrine (Ibuprofen + Pseudoephedrine Hydrochloride)
  54. Koffex DM + Decongestant + Expectorant (Dextromethorphan Hydrobromide + Guaifenesin + Pseudoephedrine Hydrochloride)
  55. Koffex DM + Decongestant + Expectorant Extra Strength (Dextromethorphan Hydrobromide + Guaifenesin + Pseudoephedrine Hydrochloride)
  56. Koffex DM + Decongestant Syrup (Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  57. Koffex DM-D-E - Liq (Dextromethorphan Hydrobromide + Guaifenesin + Pseudoephedrine Hydrochloride)
  58. Medicament Sinus Personnel Ex-Fort Caplet (Acetaminophen + Pseudoephedrine Hydrochloride)
  59. Medicament Sinus Personnel Reg Caplet (Acetaminophen + Pseudoephedrine Hydrochloride)
  60. Nasal Decongestant Antihistamine (Pseudoephedrine Hydrochloride + Triprolidine Hydrochloride)
  61. Neo Citran Daycaps Extra Strength - Caplet (Acetaminophen + Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  62. Nighttime Cold and Flu Liquid Capsules (Acetaminophen + Dextromethorphan Hydrobromide + Doxylamine Succinate + Pseudoephedrine Hydrochloride)
  63. Nighttime Cold and Flu Relief (Acetaminophen + Dextromethorphan Hydrobromide + Doxylamine Succinate + Pseudoephedrine Hydrochloride)
  64. Nitetime Cold Medicine (Acetaminophen + Dextromethorphan Hydrobromide + Doxylamine Succinate + Pseudoephedrine Hydrochloride)
  65. Novahistex DM Expectorant with Decongestant (Dextromethorphan Hydrobromide + Guaifenesin + Pseudoephedrine Hydrochloride)
  66. Novahistex DM with Decongestant (Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  67. Novahistex Expectorant with Decongestant (Guaifenesin + Pseudoephedrine Hydrochloride)
  68. Novahistine DM Expectorant with Decongestant (Dextromethorphan Hydrobromide + Guaifenesin + Pseudoephedrine Hydrochloride)
  69. Novahistine DM with Decongestant - Liq (Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  70. Nyquil Liquicaps (Acetaminophen + Dextromethorphan Hydrobromide + Doxylamine Succinate + Pseudoephedrine Hydrochloride)
  71. Once-a-Day Benylin Cold Cap (Chlorpheniramine Maleate + Pseudoephedrine Hydrochloride)
  72. Pediatric Cough Syrup (Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  73. Personnelle DM Syr (Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  74. Promatussin DM Adult Formula Syr (Dextromethorphan Hydrobromide + Promethazine Hydrochloride + Pseudoephedrine Hydrochloride)
  75. Promatussin DM Children Formula (Dextromethorphan Hydrobromide + Promethazine Hydrochloride + Pseudoephedrine Hydrochloride)
  76. Pulmosirum Decongestionnant Sirop (Beechwood Creosote + Cocillana + Eucalyptus + Guaiacol + Ipecac + Lobelia Inflata + Menthol + Myroxylon Balsamum + Pseudoephedrine Hydrochloride + White Pine)
  77. Reg.Str.Cold Medic. (Night Time Relief)Caplet (Acetaminophen + Chlorpheniramine Maleate + Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  78. Regular Strength Cold Medication (Daytime R.) (Acetaminophen + Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  79. Regular Strength Sinus Medication (Acetaminophen + Pseudoephedrine Hydrochloride)
  80. Regular Strength Sinus Medication-Caplet (Acetaminophen + Pseudoephedrine Hydrochloride)
  81. Regular Strength Tylenol Cold Chest Congestion (Acetaminophen + Dextromethorphan Hydrobromide + Guaifenesin + Pseudoephedrine Hydrochloride)
  82. Regular Strength Tylenol Cold and Flu Powder (Acetaminophen + Chlorpheniramine Maleate + Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  83. Regular Strength Tylenol Cough Suspension with Decongestant (Acetaminophen + Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  84. Robitussin Honey Cough and Cold (Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  85. Robitussin Honey Flu (Acetaminophen + Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  86. Sinus, Pain & Nasal Congest Relief Caplet (Acetaminophen + Pseudoephedrine Hydrochloride)
  87. Sinutab N.T. Regular Strength Caplets (Acetaminophen + Diphenhydramine Hydrochloride + Pseudoephedrine Hydrochloride)
  88. Sudafed Cold and Cough Extra Strength Caplet (Acetaminophen + Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  89. Sudafed Cold and Flu Gel Caps (Acetaminophen + Dextromethorphan Hydrobromide + Guaifenesin + Pseudoephedrine Hydrochloride)
  90. Sudafed DM (Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  91. Sudafed Head Cold and Sinus Extra Strength Caplets (Acetaminophen + Pseudoephedrine Hydrochloride)
  92. Sudafed Sinus Extra Strength (Acetaminophen + Pseudoephedrine Hydrochloride)
  93. Theraflu Flu Cold and Cough Medicine (Acetaminophen + Chlorpheniramine Maleate + Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  94. Triaminic Cold and Allergy (Chlorpheniramine Maleate + Pseudoephedrine Hydrochloride)
  95. Triaminic DM Expectorant Syr (Chlorpheniramine Maleate + Dextromethorphan Hydrobromide + Guaifenesin + Pseudoephedrine Hydrochloride)
  96. Triaminic DM Plus Decongestant Syrup (Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  97. Triaminic DM+Decongestant Liqui-Gels Capsules (Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  98. Triaminic Decongest+Expect Liqui-Gels Cap (Guaifenesin + Pseudoephedrine Hydrochloride)
  99. Triaminic Expectorant Syr (Chlorpheniramine Maleate + Guaifenesin + Pseudoephedrine Hydrochloride)
  100. Triaminicol DM Syrup (Chlorpheniramine Maleate + Dextromethorphan Hydrobromide + Pseudoephedrine Hydrochloride)
  101. Triprofed Tab (Pseudoephedrine Hydrochloride + Triprolidine Hydrochloride)
  102. Tussin Cough Medicine DM Antitussive Expectorant Decongestant (Dextromethorphan Hydrobromide + Guaifenesin + Pseudoephedrine Hydrochloride)
Chemical IUPAC Name (1S,2S)-2-methylamino-1-phenylpropan-1-ol
Chemical Formula C10H15NO
Chemical Structure Structure
CAS Registry Number 90-82-4
InChI Identifier InChI=1/C10H15NO/c1-8(11-2)10(12)9-6-4-3-5-7-9/h3-8,10-12H,1-2H3/t8-,10+/m0/s1
InChI Key KWGRBVOPPLSCSI-WCBMZHEXBE
KEGG Drug Not Available
KEGG Compound Not Available
PubChem Compound 7028 Link Image
PubChem Substance 150051 Link Image
ChEBI ID Not Available
PharmGKB ID Not Available
HET ID Not Available
GenBank ID Not Available
Drug ID Number [DIN] 02239134 Link Image
RxList Link http://www.rxlist.com/cgi/generic/sudafed.htm Link Image
PDRhealth Link Not Available
Wikipedia Link http://en.wikipedia.org/wiki/Pseudoephedrine Link Image
FDA Label Not Available
Material Safety Data Sheet (MSDS)
Synthesis Reference Not Available
Average Molecular Weight 165.2322
Monoisotopic Molecular Weight 165.1154
State Solid
Melting Point 117 - 118 oC
Experimental Water Solubility 7 mg/L Source: PhysProp
Predicted Water Solubility 8.26e+00 mg/mL Calculated using ALOGPS
Experimental LogP/Hydrophobicity 1.4 Source: PhysProp
Predicted LogP 1.00 Calculated using ALOGPS
Experimental LogS Not Available
Predicted LogS -1.30 Calculated using ALOGPS
Experimental Caco2 Permeability Not Available
pKa/Isoelectric Point Not Available
Mass Spectrum Not Available
MOL File Show Link Image | Download Link Image
SDF File Show Link Image | Download Link Image
PDB File Show Link Image | Download Link Image
2D Structure
3D Structure
Experimental PDB ID Not Available
Isomeric SMILES CN[C@@H](C)[C@@H](O)C1=CC=CC=C1
Canonical SMILES CNC(C)C(O)C1=CC=CC=C1
Drug Category
  • Adrenergic Agents
  • Bronchodilator Agents
  • Central Nervous System Agents
  • Nasal Decongestants
  • Sympathomimetics
  • Vasoconstrictor Agents
ATC Codes
AHFS Codes
  • 12:12.12
Indication For the treatment of nasal congestion, sinus congestion, Eustachian tube congestion, and vasomotor rhinitis, and as an adjunct to other agents in the optimum treatment of allergic rhinitis, croup, sinusitis, otitis media, and tracheobronchitis. Also used as first-line therapy of priapism.
Pharmacology Pseudoephedrine is a sympathomimetic agent, structurally similar to ephedrine, used to relieve nasal and sinus congestion and reduce air-travel-related otalgia in adults. The salts pseudoephedrine hydrochloride and pseudoephedrine sulfate are found in many over-the-counter preparations either as single-ingredient preparations, or more commonly in combination with antihistamines and/or paracetamol/ibuprofen. Unlike antihistamines, which modify the systemic histamine-mediated allergic response, pseudoephedrine only serves to relieve nasal congestion commonly associated with colds or allergies. The advantage of oral pseudoephedrine over topical nasal preparations, such as oxymetazoline, is that it does not cause rebound congestion (rhinitis medicamentosa).
Mechanism of Action Pseudoephedrine acts directly on both alpha- and, to a lesser degree, beta-adrenergic receptors. Through direct action on alpha-adrenergic receptors in the mucosa of the respiratory tract, pseudoephedrine produces vasoconstriction. Pseudoephedrine relaxes bronchial smooth muscle by stimulating beta2-adrenergic receptors. Like ephedrine, pseudoephedrine releasing norepinephrine from its storage sites, an indirect effect.
Absorption Pseudoephedrine is readily and almost completely absorbed from the GI tract and there is no evidence of first-pass metabolism.
Toxicity Common adverse reactions include nervousness, restlessness, and insomnia. Rare adverse reactions include difficult/painful urination, dizziness/lightheadedness, heart palpitations, headache, increased sweating, nausea/vomiting, trembling, troubled breathing, unusual paleness, and weakness.
Protein Binding Pseudoephedrine does not bind to human plasma proteins over the concentration range of 50 to 2000 ng/mL
Biotransformation Hepatic.
Half Life 9-16 hours
Dosage Forms
Form Route
Liquid Oral
Syrup Oral
Tablet Oral
Tablet, extended release Oral
Patient Information Show Link Image
Contraindications Show Link Image
Interactions Show Link Image
Drug Interactions
Drug Interaction
Alseroxylon Increased arterial pressure
Amitriptyline The tricyclic increases the sympathomimetic effect
Amoxapine The tricyclic increases the sympathomimetic effect
Bromocriptine The sympathomimetic increases the toxicity of bromocriptine
Clomipramine The tricyclic increases the sympathomimetic effect
Deserpidine Increased arterial pressure
Desipramine The tricyclic increases the sympathomimetic effect
Doxepin The tricyclic increases the sympathomimetic effect
Guanethidine The agent decreases the effect of guanethidine
Imipramine The tricyclic increases the sympathomimetic effect
Isocarboxazid Increased arterial pressure
Linezolid Possible increase of arterial pressure
Methyldopa Increased arterial pressure
Midodrine Increased arterial pressure
Moclobemide Moclobemide increases the sympathomimetic effect
Nortriptyline The tricyclic increases the sympathomimetic effect
Pargyline Increased arterial pressure
Phenelzine Increased arterial pressure
Protriptyline The tricyclic increases the sympathomimetic effect
Rasagiline Increased arterial pressure
Reserpine Increased arterial pressure
Tranylcypromine Increased arterial pressure
Trimipramine The tricyclic increases the sympathomimetic effect
Food Interactions
  • Take without regard to meals.
Pathways Not Available
General References
  1. Drugs.com Link Image
  2. Wikipedia Link Image
  3. RxList Link Image
Organisms Affected
  • Humans and other mammals
Phase 1 Metabolizing Enzymes
  1. Monoamine oxidase type A (MAO-A)
Targets
  1. Alpha-2A adrenergic receptor
  2. Alpha-1A adrenergic receptor
  3. Beta-2 adrenergic receptor
Phase 1 Metabolizing Enzyme 1 [top]
Enzyme 1 Name Monoamine oxidase type A (MAO-A)
Enzyme 1 Gene Name MAOA
Enzyme 1 SwissProt ID P21397 Link Image
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 Protein Sequence >sp|P21397|AOFA_HUMAN Amine oxidase [flavin-containing] 
MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHV
DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL
NHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADR
LAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKD
VPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS
Drug Target 1 [top]
Target 1 ID 318
Target 1 Name Alpha-2A adrenergic receptor
Target 1 Synonyms
  1. Alpha-2 adrenergic receptor subtype C10
  2. Alpha-2A adrenoceptor
  3. Alpha-2A adrenoreceptor
  4. Alpha-2AAR
Target 1 Gene Name ADRA2A
Target 1 Protein Sequence >Alpha-2A adrenergic receptor 
MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLLTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVISFPPLISIEKKGGGGG
PQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAVA
APPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGPRDTDALDLEESSSSD
HAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTPAAGPGEERVGAAKAS
RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPRTLFKFFFWFGYCNSS
LNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Target 1 Number of Residues 457
Target 1 Molecular Weight 48957
Target 1 Theoretical pI 10.20
Target 1 GO Classification
Function
signal transducer activity
receptor activity
transmembrane receptor activity
G-protein coupled receptor activity
rhodopsin-like receptor activity
amine receptor activity
adrenoceptor activity
alpha-adrenergic receptor activity
alpha2-adrenergic receptor activity
Process
cellular process
cell communication
signal transduction
cell surface receptor linked signal transduction
G-protein coupled receptor protein signaling pathway
Component
cell
membrane
intrinsic to membrane
integral to membrane
Target 1 General Function Involved in alpha2-adrenergic receptor activity
Target 1 Specific Function Alpha-2 adrenergic receptors mediate the catecholamine- induced inhibition of adenylate cyclase through the action of G proteins. The rank order of potency for agonists of this receptor is oxymetazoline > clonidine > epinephrine > norepinephrine > phenylephrine > dopamine > p-synephrine > p-tyramine > serotonin = p-octopamine. For antagonists, the rank order is yohimbine > phentolamine = mianserine > chlorpromazine = spiperone = prazosin > propanolol > alprenolol = pindolol
Target 1 Pathways Not Available
Target 1 Reactions Not Available
Target 1 Pfam Domain Function
Target 1 Signals
  • None
Target 1 Transmembrane Regions
  • 34-59
  • 71-96
  • 107-129
  • 150-173
  • 193-217
  • 375-399
  • 407-430
Target 1 Essentiality Non-Essential
Target 1 GenBank ID Protein 178196 Link Image
Target 1 UniProtKB/Swiss-Prot ID P08913 Link Image
Target 1 UniProtKB/Swiss-Prot Entry Name ADA2A_HUMAN Link Image
Target 1 PDB ID 1HOF Link Image
Target 1 PDB File Show
Target 1 3D Structure
Target 1 Cellular Location
  • Membrane
  • multi-pass membrane protein
Target 1 Gene Sequence >1353 bp 
ATGGGCTCCCTGCAGCCGGACGCGGGCAACGCGAGCTGGAACGGGACCGAGGCGCCGGGG
GGCGGCGCCCGGGCCACCCCTTACTCCCTGCAGGTGACGCTGACGCTGGTGTGCCTGGCC
GGCCTGCTCATGCTGCTCACCGTGTTCGGCAACGTGCTCGTCATCATCGCCGTGTTCACG
AGCCGCGCGCTCAAGGCGCCCCAAAACCTCTTCCTGGTGTCTCTGGCCTCGGCCGACATC
CTGGTGGCCACGCTCGTCATCCCTTTCTCGCTGGCCAACGAGGTCATGGGCTACTGGTAC
TTCGGCAAGGCTTGGTGCGAGATCTACCTGGCGCTCGACGTGCTCTTCTGCACGTCGTCC
ATCGTGCACCTGTGCGCCATCAGCCTGGACCGCTACTGGTCCATCACACAGGCCATCGAG
TACAACCTGAAGCGCACGCCGCGCCGCATCAAGGCCATCATCATCACCGTGTGGGTCATC
TCGGCCGTCATCTCCTTCCCGCCGCTCATCTCCATCGAGAAGAAGGGCGGCGGCGGCGGC
CCGCAGCCGGCCGAGCCGCGCTGCGAGATCAACGACCAGAAGTGGTACGTCATCTCGTCG
TGCATCGGCTCCTTCTTCGCTCCCTGCCTCATCATGATCCTGGTCTACGTGCGCATCTAC
CAGATCGCCAAGCGTCGCACCCGCGTGCCACCCAGCCGCCGGGGTCCGGACGCCGTCGCC
GCGCCGCCGGGGGGCACCGAGCGCAGGCCCAACGGTCTGGGCCCCGAGCGCAGCGCGGGC
CCGGGGGGCGCAGAGGCCGAACCGCTGCCCACCCAGCTCAACGGCGCCCCTGGCGAGCCC
GCGCCGGCCGGGCCGCGCGACACCGACGCGCTGGACCTGGAGGAGAGCTCGTCTTCCGAC
CACGCCGAGCGGCCTCCAGGGCCCCGCAGACCCGAGCGCGGTCCCCGGGGCAAAGGCAAG
GCCCGAGCGAGCCAGGTGAAGCCGGGCGACAGCCTGCGCGGCGCGGGCCGGGGGCGACGG
GGATCGGGACGCCGGCTGCAGGGCCGGGGGAGGAGCGCGTCGGGGCTGCCAAGGCGTCGC
GCTGGCGCGGGCGGGCAGAACCGCGAGAAGCGCTTCACGTTCGTGCTGGCCGTGGTCATC
GGAGTGTTCGTGGTGTGCTGGTTCCCCTTCTTCTTCACCTACACGCTCACGGCCGTCGGG
TGCTCCGTGCCACGCACGCTCTTCAAATTCTTCTTCTGGTTCGGCTACTGCAACAGCTCG
TTGAACCCGGTCATCTACACCATCTTCAACCACGATTTCCGCCGCGCCTTCAAGAAGATC
CTCTGTCGGGGGGACAGGAAGCGGATCGTGTGA
Target 1 GenBank Gene ID
Target 1 GeneCard ID ADRA2A Link Image
Target 1 GenAtlas ID ADRA2A Link Image
Target 1 HGNC ID HGNC:281 Link Image
Target 1 Chromosome Location 10
Target 1 Locus 10q24-q26
Target 1 SNPs SNPJam Report Link Image
Target 1 General References
  1. Chung DA, Zuiderweg ER, Fowler CB, Soyer OS, Mosberg HI, Neubig RR: NMR structure of the second intracellular loop of the alpha 2A adrenergic receptor: evidence for a novel cytoplasmic helix. Biochemistry. 2002 Mar 19;41(11):3596-604. [PubMed Link Image]
  2. Suryanarayana S, Daunt DA, Von Zastrow M, Kobilka BK: A point mutation in the seventh hydrophobic domain of the alpha 2 adrenergic receptor increases its affinity for a family of beta receptor antagonists. J Biol Chem. 1991 Aug 15;266(23):15488-92. [PubMed Link Image]
  3. Wang CD, Buck MA, Fraser CM: Site-directed mutagenesis of alpha 2A-adrenergic receptors: identification of amino acids involved in ligand binding and receptor activation by agonists. Mol Pharmacol. 1991 Aug;40(2):168-79. [PubMed Link Image]
  4. Chhajlani V, Rangel N, Uhlen S, Wikberg JE: Identification of an additional gene belonging to the alpha 2 adrenergic receptor family in the human genome by PCR. FEBS Lett. 1991 Mar 25;280(2):241-4. [PubMed Link Image]
  5. Guyer CA, Horstman DA, Wilson AL, Clark JD, Cragoe EJ Jr, Limbird LE: Cloning, sequencing, and expression of the gene encoding the porcine alpha 2-adrenergic receptor. Allosteric modulation by Na+, H+, and amiloride analogs. J Biol Chem. 1990 Oct 5;265(28):17307-17. [PubMed Link Image]
  6. Fraser CM, Arakawa S, McCombie WR, Venter JC: Cloning, sequence analysis, and permanent expression of a human alpha 2-adrenergic receptor in Chinese hamster ovary cells. Evidence for independent pathways of receptor coupling to adenylate cyclase attenuation and activation. J Biol Chem. 1989 Jul 15;264(20):11754-61. [PubMed Link Image]
  7. Kobilka BK, Matsui H, Kobilka TS, Yang-Feng TL, Francke U, Caron MG, Lefkowitz RJ, Regan JW: Cloning, sequencing, and expression of the gene coding for the human platelet alpha 2-adrenergic receptor. Science. 1987 Oct 30;238(4827):650-6. [PubMed Link Image]
Target 1 Drug References
  1. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed Link Image]
  2. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed Link Image]
Drug Target 2 [top]
Target 2 ID 556
Target 2 Name Alpha-1A adrenergic receptor
Target 2 Synonyms
  1. Alpha 1A- adrenoreceptor
  2. Alpha 1A-adrenoceptor
  3. Alpha adrenergic receptor 1c
  4. Alpha-1C adrenergic receptor
Target 2 Gene Name ADRA1A
Target 2 Protein Sequence >Alpha-1A adrenergic receptor 
MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
APAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTL
HPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
TARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV
Target 2 Number of Residues 473
Target 2 Molecular Weight 51487
Target 2 Theoretical pI 9.23
Target 2 GO Classification
Function
signal transducer activity
receptor activity
transmembrane receptor activity
G-protein coupled receptor activity
rhodopsin-like receptor activity
amine receptor activity
adrenoceptor activity
alpha-adrenergic receptor activity
alpha1-adrenergic receptor activity
Process
cellular process
cell communication
signal transduction
cell surface receptor linked signal transduction
G-protein coupled receptor protein signaling pathway
Component
cell
membrane
intrinsic to membrane
integral to membrane
Target 2 General Function Involved in alpha1-adrenergic receptor activity
Target 2 Specific Function This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol- calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins
Target 2 Pathways Not Available
Target 2 Reactions Not Available
Target 2 Pfam Domain Function
Target 2 Signals
  • None
Target 2 Transmembrane Regions
  • 28-51
  • 65-88
  • 100-122
  • 144-167
  • 182-205
  • 274-297
  • 306-329
Target 2 Essentiality Non-Essential
Target 2 GenBank ID Protein 433201 Link Image
Target 2 UniProtKB/Swiss-Prot ID P35348 Link Image
Target 2 UniProtKB/Swiss-Prot Entry Name ADA1A_HUMAN Link Image
Target 2 PDB ID Not Available
Target 2 Cellular Location
  • Membrane
  • multi-pass membrane protein
Target 2 Gene Sequence >1401 bp 
ATGGTGTTTCTCTCGGGAAATGCTTCCGACAGCTCCAACTGCACCCAACCGCCGGCACCG
GTGAACATTTCCAAGGCCATTCTGCTCGGGGTGATCTTGGGGGGCCTCATTCTTTTCGGG
GTGCTGGGTAACATCCTAGTGATCCTCTCCGTAGCCTGTCACCGACACCTGCACTCAGTC
ACGCACTACTACATCGTCAACCTGGCGGTGGCCGACCTCCTGCTCACCTCCACGGTGCTG
CCCTTCTCCGCCATCTTCGAGGTCCTAGGCTACTGGGCCTTCGGCAGGGTCTTCTGCAAC
ATCTGGGCGGCAGTGGATGTGCTGTGCTGCACCGCGTCCATCATGGGCCTCTGCATCATC
TCCATCGACCGCTACATCGGCGTGAGCTACCCGCTGCGCTACCCAACCATCGTCACCCAG
AGGAGGGGTCTCATGGCTCTGCTCTGCGTCTGGGCACTCTCCCTGGTCATATCCATTGGA
CCCCTGTTCGGCTGGAGGCAGCCGGCCCCCGAGGACGAGACCATCTGCCAGATCAACGAG
GAGCCGGGCTACGTGCTCTTCTCAGCGCTGGGCTCCTTCTACCTGCCTCTGGCCATCATC
CTGGTCATGTACTGCCGCGTCTACGTGGTGGCCAAGAGGGAGAGCCGGGGCCTCAAGTCT
GGCCTCAAGACCGACAAGTCGGACTCGGAGCAAGTGACGCTCCGCATCCATCGGAAAAAC
GCCCCGGCAGGAGGCAGCGGGATGGCCAGCGCCAAGACCAAGACGCACTTCTCAGTGAGG
CTCCTCAAGTTCTCCCGGGAGAAGAAAGCGGCCAAAACGCTGGGCATCGTGGTCGGCTGC
TTCGTCCTCTGCTGGCTGCCTTTTTTCTTAGTCATGCCCATTGGGTCTTTCTTCCCTGAT
TTCAAGCCCTCTGAAACAGTTTTTAAAATAGTATTTTGGCTCGGATATCTAAACAGCTGC
ATCAACCCCATCATATACCCATGCTCCAGCCAAGAGTTCAAAAAGGCCTTTCAGAATGTC
TTGAGAATCCAGTGTCTCCGCAGAAAGCAGTCTTCCAAACATGCCCTGGGCTACACCCTG
CACCCGCCCAGCCAGGCCGTGGAAGGGCAACACAAGGACATGGTGCGCATCCCCGTGGGA
TCAAGAGAGACCTTCTACAGGATCTCCAAGACGGATGGCGTTTGTGAATGGAAATTTTTC
TCTTCCATGCCCCGTGGATCTGCCAGGATTACAGTGTCCAAAGACCAATCCTCCTGTACC
ACAGCCCGGGTGAGAAGTAAAAGCTTTTTGGAGGTCTGCTGCTGTGTAGGGCCCTCAACC
CCCAGCCTTGACAAGAACCATCAAGTTCCAACCATTAAGGTCCACACCATCTCCCTCAGT
GAGAACGGGGAGGAAGTCTAG
Target 2 GenBank Gene ID
Target 2 GeneCard ID ADRA1A Link Image
Target 2 GenAtlas ID ADRA1A Link Image
Target 2 HGNC ID HGNC:277 Link Image
Target 2 Chromosome Location 8
Target 2 Locus 8p21-p11.2
Target 2 SNPs SNPJam Report Link Image
Target 2 General References
  1. Hirasawa A, Shibata K, Horie K, Takei Y, Obika K, Tanaka T, Muramoto N, Takagaki K, Yano J, Tsujimoto G: Cloning, functional expression and tissue distribution of human alpha 1c-adrenoceptor splice variants. FEBS Lett. 1995 Apr 24;363(3):256-60. [PubMed Link Image]
  2. Schwinn DA, Johnston GI, Page SO, Mosley MJ, Wilson KH, Worman NP, Campbell S, Fidock MD, Furness LM, Parry-Smith DJ, et al.: Cloning and pharmacological characterization of human alpha-1 adrenergic receptors: sequence corrections and direct comparison with other species homologues. J Pharmacol Exp Ther. 1995 Jan;272(1):134-42. [PubMed Link Image]
  3. Weinberg DH, Trivedi P, Tan CP, Mitra S, Perkins-Barrow A, Borkowski D, Strader CD, Bayne M: Cloning, expression and characterization of human alpha adrenergic receptors alpha 1a, alpha 1b and alpha 1c. Biochem Biophys Res Commun. 1994 Jun 30;201(3):1296-304. [PubMed Link Image]
  4. Forray C, Bard JA, Wetzel JM, Chiu G, Shapiro E, Tang R, Lepor H, Hartig PR, Weinshank RL, Branchek TA, et al.: The alpha 1-adrenergic receptor that mediates smooth muscle contraction in human prostate has the pharmacological properties of the cloned human alpha 1c subtype. Mol Pharmacol. 1994 Apr;45(4):703-8. [PubMed Link Image]
  5. Hirasawa A, Horie K, Tanaka T, Takagaki K, Murai M, Yano J, Tsujimoto G: Cloning, functional expression and tissue distribution of human cDNA for the alpha 1C-adrenergic receptor. Biochem Biophys Res Commun. 1993 Sep 15;195(2):902-9. [PubMed Link Image]
  6. Tseng-Crank J, Kost T, Goetz A, Hazum S, Roberson KM, Haizlip J, Godinot N, Robertson CN, Saussy D: The alpha 1C-adrenoceptor in human prostate: cloning, functional expression, and localization to specific prostatic cell types. Br J Pharmacol. 1995 Aug;115(8):1475-85. [PubMed Link Image]
  7. Chang DJ, Chang TK, Yamanishi SS, Salazar FH, Kosaka AH, Khare R, Bhakta S, Jasper JR, Shieh IS, Lesnick JD, Ford AP, Daniels DV, Eglen RM, Clarke DE, Bach C, Chan HW: Molecular cloning, genomic characterization and expression of novel human alpha1A-adrenoceptor isoforms. FEBS Lett. 1998 Jan 30;422(2):279-83. [PubMed Link Image]
Target 2 Drug References
  1. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed Link Image]
  2. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed Link Image]
Drug Target 3 [top]
Target 3 ID 766
Target 3 Name Beta-2 adrenergic receptor
Target 3 Synonyms
  1. Beta-2 adrenoceptor
  2. Beta-2 adrenoreceptor
Target 3 Gene Name ADRB2
Target 3 Protein Sequence >Beta-2 adrenergic receptor 
MGQPGNGSAFLLAPNRSHAPDHDVTQQRDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAK
FERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTAS
IETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQE
AINCYANETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRF
HVQNLSQVEQDGRTGHGLRRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQD
NLIRKEVYILLNWIGYVNSGFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGYSSNGNT
GEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLL
Target 3 Number of Residues 419
Target 3 Molecular Weight 46557
Target 3 Theoretical pI 7.44
Target 3 GO Classification
Function
signal transducer activity
receptor activity
transmembrane receptor activity
G-protein coupled receptor activity
rhodopsin-like receptor activity
amine receptor activity
adrenoceptor activity
beta-adrenergic receptor activity
beta2-adrenergic receptor activity
Process
cellular process
cell communication
signal transduction
cell surface receptor linked signal transduction
G-protein coupled receptor protein signaling pathway
Component
cell
membrane
intrinsic to membrane
integral to membrane
Target 3 General Function Involved in beta2-adrenergic receptor activity
Target 3 Specific Function Beta-adrenergic receptors mediate the catecholamine- induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine
Target 3 Pathways Not Available
Target 3 Reactions Not Available
Target 3 Pfam Domain Function
Target 3 Signals
  • None
Target 3 Transmembrane Regions
  • 35-58
  • 72-95
  • 107-129
  • 151-174
  • 197-220
  • 275-298
  • 306-329
Target 3 Essentiality Non-Essential
Target 3 GenBank ID Protein 29371 Link Image
Target 3 UniProtKB/Swiss-Prot ID P07550 Link Image
Target 3 UniProtKB/Swiss-Prot Entry Name ADRB2_HUMAN Link Image
Target 3 PDB ID Not Available
Target 3 Cellular Location
  • Membrane
  • multi-pass membrane protein
Target 3 Gene Sequence >1242 bp 
ATGGGGCAACCCGGGAACGGCAGCGCCTTCTTGCTGGCACCCAATAGAAGCCATGCGCCG
GACCACGACGTCACGCAGCAAAGGGACGAGGTGTGGGTGGTGGGCATGGGCATCGTCATG
TCTCTCATCGTCCTGGCCATCGTGTTTGGCAATGTGCTGGTCATCACAGCCATTGCCAAG
TTCGAGCGTCTGCAGACGGTCACCAACTACTTCATCACTTCACTGGCCTGTGCTGATCTG
GTCATGGGCCTGGCAGTGGTGCCCTTTGGGGCCGCCCATATTCTTATGAAAATGTGGACT
TTTGGCAACTTCTGGTGCGAGTTTTGGACTTCCATTGATGTGCTGTGCGTCACGGCCAGC
ATTGAGACCCTGTGCGTGATCGCAGTGGATCGCTACTTTGCCATTACTTCACCTTTCAAG
TACCAGAGCCTGCTGACCAAGAATAAGGCCCGGGTGATCATTCTGATGGTGTGGATTGTG
TCAGGCCTTACCTCCTTCTTGCCCATTCAGATGCACTGGTACCGGGCCACCCACCAGGAA
GCCATCAACTGCTATGCCAATGAGACCTGCTGTGACTTCTTCACGAACCAAGCCTATGCC
ATTGCCTCTTCCATCGTGTCCTTCTACGTTCCCCTGGTGATCATGGTCTTCGTCTACTCC
AGGGTCTTTCAGGAGGCCAAAAGGCAGCTCCAGAAGATTGACAAATCTGAGGGCCGCTTC
CATGTCCAGAACCTTAGCCAGGTGGAGCAGGATGGGCGGACGGGGCATGGACTCCGCAGA
TCTTCCAAGTTCTGCTTGAAGGAGCACAAAGCCCTCAAGACGTTAGGCATCATCATGGGC
ACTTTCACCCTCTGCTGGCTGCCCTTCTTCATCGTTAACATTGTGCATGTGATCCAGGAT
AACCTCATCCGTAAGGAAGTTTACATCCTCCTAAATTGGATAGGCTATGTCAATTCTGGT
TTCAATCCCCTTATCTACTGCCGGAGCCCAGATTTCAGGATTGCCTTCCAGGAGCTTCTG
TGCCTGCGCAGGTCTTCTTTGAAGGCCTATGGGAATGGCTACTCCAGCAACGGCAACACA
GGGGAGCAGAGTGGATATCACGTGGAACAGGAGAAAGAAAATAAACTGCTGTGTGAAGAC
CTCCCAGGCACGGAAGACTTTGTGGGCCATCAAGGTACTGTGCCTAGCGATAACATTGAT
TCACAAGGGAGGAATTGTAGTACAAATGACTCACTGCTGTAA
Target 3 GenBank Gene ID
Target 3 GeneCard ID ADRB2 Link Image
Target 3 GenAtlas ID ADRB2 Link Image
Target 3 HGNC ID HGNC:286 Link Image
Target 3 Chromosome Location 5
Target 3 Locus 5q31-q32
Target 3 SNPs SNPJam Report Link Image
Target 3 General References
  1. Cao TT, Deacon HW, Reczek D, Bretscher A, von Zastrow M: A kinase-regulated PDZ-domain interaction controls endocytic sorting of the beta2-adrenergic receptor. Nature. 1999 Sep 16;401(6750):286-90. [PubMed Link Image]
  2. Moffett S, Rousseau G, Lagace M, Bouvier M: The palmitoylation state of the beta(2)-adrenergic receptor regulates the synergistic action of cyclic AMP-dependent protein kinase and beta-adrenergic receptor kinase involved in its phosphorylation and desensitization. J Neurochem. 2001 Jan;76(1):269-79. [PubMed Link Image]
  3. O'Dowd BF, Hnatowich M, Caron MG, Lefkowitz RJ, Bouvier M: Palmitoylation of the human beta 2-adrenergic receptor. Mutation of Cys341 in the carboxyl tail leads to an uncoupled nonpalmitoylated form of the receptor. J Biol Chem. 1989 May 5;264(13):7564-9. [PubMed Link Image]
  4. Emorine LJ, Marullo S, Delavier-Klutchko C, Kaveri SV, Durieu-Trautmann O, Strosberg AD: Structure of the gene for human beta 2-adrenergic receptor: expression and promoter characterization. Proc Natl Acad Sci U S A. 1987 Oct;84(20):6995-9. [PubMed Link Image]
  5. Chung FZ, Wang CD, Potter PC, Venter JC, Fraser CM: Site-directed mutagenesis and continuous expression of human beta-adrenergic receptors. Identification of a conserved aspartate residue involved in agonist binding and receptor activation. J Biol Chem. 1988 Mar 25;263(9):4052-5. [PubMed Link Image]
  6. Kobilka BK, Dixon RA, Frielle T, Dohlman HG, Bolanowski MA, Sigal IS, Yang-Feng TL, Francke U, Caron MG, Lefkowitz RJ: cDNA for the human beta 2-adrenergic receptor: a protein with multiple membrane-spanning domains and encoded by a gene whose chromosomal location is shared with that of the receptor for platelet-derived growth factor. Proc Natl Acad Sci U S A. 1987 Jan;84(1):46-50. [PubMed Link Image]
  7. Chung FZ, Lentes KU, Gocayne J, Fitzgerald M, Robinson D, Kerlavage AR, Fraser CM, Venter JC: Cloning and sequence analysis of the human brain beta-adrenergic receptor. Evolutionary relationship to rodent and avian beta-receptors and porcine muscarinic receptors. FEBS Lett. 1987 Jan 26;211(2):200-6. [PubMed Link Image]
  8. Schofield PR, Rhee LM, Peralta EG: Primary structure of the human beta-adrenergic receptor gene. Nucleic Acids Res. 1987 Apr 24;15(8):3636. [PubMed Link Image]
  9. Kobilka BK, Frielle T, Dohlman HG, Bolanowski MA, Dixon RA, Keller P, Caron MG, Lefkowitz RJ: Delineation of the intronless nature of the genes for the human and hamster beta 2-adrenergic receptor and their putative promoter regions. J Biol Chem. 1987 May 25;262(15):7321-7. [PubMed Link Image]
  10. Turki J, Pak J, Green SA, Martin RJ, Liggett SB: Genetic polymorphisms of the beta 2-adrenergic receptor in nocturnal and nonnocturnal asthma. Evidence that Gly16 correlates with the nocturnal phenotype. J Clin Invest. 1995 Apr;95(4):1635-41. [PubMed Link Image]
  11. 7915137 Green SA, Turki J, Innis M, Liggett SB: Amino-terminal polymorphisms of the human beta 2-adrenergic receptor impart distinct agonist-promoted regulatory properties. Biochemistry. 1994 Aug 16;33(32):9414-9.
  12. 8383511 Reihsaus E, Innis M, MacIntyre N, Liggett SB: Mutations in the gene encoding for the beta 2-adrenergic receptor in normal and asthmatic subjects. Am J Respir Cell Mol Biol. 1993 Mar;8(3):334-9.
Target 3 Drug References
  1. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed Link Image]
  2. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed Link Image]

This project is supported by Genome Alberta & Genome Canada, a not-for-profit organization that is leading Canada's national genomics strategy with $600 million in funding from the federal government. This project is also supported in part by GenomeQuest, Inc., an enterprise genomic information company serving the life science community.