You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameDulaglutide
Accession NumberDB09045
TypeBiotech
GroupsApproved
DescriptionDulaglutide is a novel glucagon-like peptide-1 agonist (GLP-1) biologic drug consisting of a dipeptidyl peptidase-IV-protected GLP-1 analogue covalently linked to a human IgG4-Fc heavy chain by a small peptide linker. Dulaglutide is indicated in the treatment of type 2 diabetes and can be used once a week. It was approved by the FDA in September 2014. Dulaglutide is manufactured and marketed by Eli Lily under the brand Trulicity™. It is not known if dulaglutide can increase the risk of medullary thyroid carcinoma or multiple endocrine neoplasia syndrome type 2, and is thus not recommended for use in populations with a personal or family history of these conditions.
Protein structureDb09045
Related Articles
Protein chemical formulaC2646H4044N704O836S18
Protein average weight59669.81 Da
Sequences
> Dulaglutide Sequence
HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGGGGGGSGGGGSGGGGSAESKYGPPCPPCPA
PEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKP
REEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTL
PPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLT
VDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG
Download FASTA Format
SynonymsNot Available
External Identifiers
  • LY-2189265
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
Trulicityinjection, solution.75 mg/.5mLsubcutaneousEli Lilly and Company2014-11-07Not applicableUs
Trulicitysolution0.75 mgsubcutaneousEli Lilly Canada IncNot applicableNot applicableCanada
Trulicityinjection, solution1.5 mg/.5mLsubcutaneousEli Lilly and Company2014-11-07Not applicableUs
Trulicitysolution1.5 mgsubcutaneousEli Lilly Canada IncNot applicableNot applicableCanada
Trulicitysolution0.75 mgsubcutaneousEli Lilly Canada Inc2016-01-08Not applicableCanada
Trulicitysolution1.5 mgsubcutaneousEli Lilly Canada Inc2015-11-24Not applicableCanada
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
SaltsNot Available
Categories
UNIIWTT295HSY5
CAS number923950-08-7
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available
Pharmacology
IndicationIndicated as an adjunct to diet and exercise to improve glycemic control in adults with type 2 diabetes mellitus.
PharmacodynamicsDulaglutide activates human glucagon-like peptide-1 receptors, thus increasing intracellular cyclic AMP in beta cells. This, in turn, increases glucose-dependent insulin release. Dulaglutide also reduces glucagon secretion and slows gastric emptying.
Mechanism of actionDulaglutide is a human GLP-1 receptor agonist with 90% amino acid sequence homology to endogenous human GLP-1 (7-37). Dulaglutide activates the GLP-1 receptor, a membrane-bound cell-surface receptor coupled to adenylyl cyclase in pancreatic beta cells. Dulaglutide increases intracellular cyclic AMP (cAMP) in beta cells leading to glucose-dependent insulin release. Dulaglutide also decreases glucagon secretion and slows gastric emptying.
Related Articles
AbsorptionMaximum plasma concentration (Cmax) is achieved in 24–72 h (median 48 h) after a subcutaneous injection administered at a steady state.
Volume of distribution

After subcutaneous administration of 0.75 mg and 1.5 mg to steady state were approximately 19.2 L (range 14.3 to 26.4 L) and 17.4 L (range 9.3 to 33 L), respectively.

Protein bindingNot Available
Metabolism

Dulaglutide is presumed to be degraded into its component amino acids by general protein catabolism pathways.

Route of eliminationNot Available
Half lifeApproximately 5 days.
Clearance

The mean apparent clearance at steady state of dulaglutide is approximately 0.111 L/h for the 0.75 mg dose, and 0.107 L/h for the 1.5 mg dose.

Toxicity-RISK OF THYROID C-CELL TUMORS -Dulaglutide is contraindicated in patients with a personal or family history of MTC or in patients with Multiple Endocrine Neoplasia syndrome type 2 (MEN2). Routine serum calcitonin or thyroid ultrasound monitoring is of uncertain value in patients treated with Dulaglutide.
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Pharmacoeconomics
ManufacturersNot Available
PackagersNot Available
Dosage forms
FormRouteStrength
Injection, solutionsubcutaneous.75 mg/.5mL
Injection, solutionsubcutaneous1.5 mg/.5mL
Solutionsubcutaneous0.75 mg
Solutionsubcutaneous1.5 mg
PricesNot Available
PatentsNot Available
Properties
StateLiquid
Experimental PropertiesNot Available
References
Synthesis ReferenceNot Available
General References
  1. Nadkarni P, Chepurny OG, Holz GG: Regulation of glucose homeostasis by GLP-1. Prog Mol Biol Transl Sci. 2014;121:23-65. doi: 10.1016/B978-0-12-800101-1.00002-8. [PubMed:24373234 ]
  2. Sanford M: Dulaglutide: first global approval. Drugs. 2014 Nov;74(17):2097-103. doi: 10.1007/s40265-014-0320-7. [PubMed:25367716 ]
External Links
ATC CodesA10BX14
AHFS CodesNot Available
PDB EntriesNot Available
FDA labelNot Available
MSDSDownload (97.1 KB)
Interactions
Drug Interactions
Drug
7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE7,8-DICHLORO-1,2,3,4-TETRAHYDROISOQUINOLINE may increase the hypoglycemic activities of Dulaglutide.
AcetohexamideDulaglutide may increase the hypoglycemic activities of Acetohexamide.
Acetylsalicylic acidAcetylsalicylic acid may increase the hypoglycemic activities of Dulaglutide.
Aminosalicylic AcidAminosalicylic Acid may increase the hypoglycemic activities of Dulaglutide.
AmoxapineAmoxapine may increase the hypoglycemic activities of Dulaglutide.
AripiprazoleThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Aripiprazole.
Arsenic trioxideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Arsenic trioxide.
ArticaineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Articaine.
AsenapineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Asenapine.
AtazanavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Atazanavir.
BendroflumethiazideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Bendroflumethiazide.
BenmoxinBenmoxin may increase the hypoglycemic activities of Dulaglutide.
BetamethasoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Betamethasone.
BrexpiprazoleThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Brexpiprazole.
BumetanideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Bumetanide.
BuserelinThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Buserelin.
CaroxazoneCaroxazone may increase the hypoglycemic activities of Dulaglutide.
CeritinibThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Ceritinib.
ChlorothiazideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Chlorothiazide.
ChlorpropamideDulaglutide may increase the hypoglycemic activities of Chlorpropamide.
ChlorthalidoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Chlorthalidone.
CitalopramCitalopram may increase the hypoglycemic activities of Dulaglutide.
ClomipramineClomipramine may increase the hypoglycemic activities of Dulaglutide.
ClozapineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Clozapine.
CorticotropinThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Corticotropin.
Cortisone acetateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Cortisone acetate.
Cyproterone acetateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Cyproterone acetate.
DabrafenibThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Dabrafenib.
DanazolThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Danazol.
DapoxetineDapoxetine may increase the hypoglycemic activities of Dulaglutide.
DarunavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Darunavir.
DesogestrelThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Desogestrel.
DexamethasoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Dexamethasone.
DiazoxideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Diazoxide.
DienogestThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Dienogest.
DiflunisalDiflunisal may increase the hypoglycemic activities of Dulaglutide.
DihydrotestosteroneDihydrotestosterone may increase the hypoglycemic activities of Dulaglutide.
DisopyramideDulaglutide may increase the hypoglycemic activities of Disopyramide.
DrospirenoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Drospirenone.
EpinephrineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Epinephrine.
EscitalopramEscitalopram may increase the hypoglycemic activities of Dulaglutide.
EstradiolThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Estradiol.
Estrone sulfateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Estrone sulfate.
Etacrynic acidThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Etacrynic acid.
Ethinyl EstradiolThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Ethinyl Estradiol.
Ethynodiol diacetateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Ethynodiol diacetate.
EtonogestrelThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Etonogestrel.
EtoperidoneEtoperidone may increase the hypoglycemic activities of Dulaglutide.
EverolimusThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Everolimus.
FenfluramineFenfluramine may increase the hypoglycemic activities of Dulaglutide.
FludrocortisoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Fludrocortisone.
FluoxetineFluoxetine may increase the hypoglycemic activities of Dulaglutide.
FluoxymesteroneFluoxymesterone may increase the hypoglycemic activities of Dulaglutide.
FluvoxamineFluvoxamine may increase the hypoglycemic activities of Dulaglutide.
FosamprenavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Fosamprenavir.
FurazolidoneFurazolidone may increase the hypoglycemic activities of Dulaglutide.
FurosemideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Furosemide.
GlibornurideDulaglutide may increase the hypoglycemic activities of Glibornuride.
GliclazideDulaglutide may increase the hypoglycemic activities of Gliclazide.
GlimepirideDulaglutide may increase the hypoglycemic activities of Glimepiride.
GlipizideDulaglutide may increase the hypoglycemic activities of Glipizide.
GliquidoneDulaglutide may increase the hypoglycemic activities of Gliquidone.
GlisoxepideDulaglutide may increase the hypoglycemic activities of Glisoxepide.
GlyburideDulaglutide may increase the hypoglycemic activities of Glyburide.
GoserelinThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Goserelin.
HistrelinThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Histrelin.
HydracarbazineHydracarbazine may increase the hypoglycemic activities of Dulaglutide.
HydrochlorothiazideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Hydrochlorothiazide.
HydrocortisoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Hydrocortisone.
HydroflumethiazideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Hydroflumethiazide.
Hydroxyprogesterone caproateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Hydroxyprogesterone caproate.
IloperidoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Iloperidone.
IndalpineIndalpine may increase the hypoglycemic activities of Dulaglutide.
IndapamideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Indapamide.
IndinavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Indinavir.
Insulin AspartDulaglutide may increase the hypoglycemic activities of Insulin Aspart.
Insulin DetemirDulaglutide may increase the hypoglycemic activities of Insulin Detemir.
Insulin GlargineDulaglutide may increase the hypoglycemic activities of Insulin Glargine.
Insulin GlulisineDulaglutide may increase the hypoglycemic activities of Insulin Glulisine.
Insulin HumanDulaglutide may increase the hypoglycemic activities of Insulin Human.
Insulin LisproDulaglutide may increase the hypoglycemic activities of Insulin Lispro.
Insulin PorkDulaglutide may increase the hypoglycemic activities of Insulin Pork.
IproclozideIproclozide may increase the hypoglycemic activities of Dulaglutide.
IproniazidIproniazid may increase the hypoglycemic activities of Dulaglutide.
IsocarboxazidIsocarboxazid may increase the hypoglycemic activities of Dulaglutide.
LanreotideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Lanreotide.
LanreotideDulaglutide may increase the hypoglycemic activities of Lanreotide.
LeuprolideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Leuprolide.
LevomilnacipranLevomilnacipran may increase the hypoglycemic activities of Dulaglutide.
LevonorgestrelThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Levonorgestrel.
Lipoic AcidLipoic Acid may increase the hypoglycemic activities of Dulaglutide.
LopinavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Lopinavir.
Lu AA21004Lu AA21004 may increase the hypoglycemic activities of Dulaglutide.
LurasidoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Lurasidone.
MebanazineMebanazine may increase the hypoglycemic activities of Dulaglutide.
MecaserminDulaglutide may increase the hypoglycemic activities of Mecasermin.
Medroxyprogesterone acetateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Medroxyprogesterone acetate.
Megestrol acetateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Megestrol acetate.
MesalazineMesalazine may increase the hypoglycemic activities of Dulaglutide.
MestranolThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Mestranol.
MethotrimeprazineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Methotrimeprazine.
MethyclothiazideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Methyclothiazide.
Methylene blueMethylene blue may increase the hypoglycemic activities of Dulaglutide.
MethylprednisoloneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Methylprednisolone.
MethyltestosteroneMethyltestosterone may increase the hypoglycemic activities of Dulaglutide.
MetolazoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Metolazone.
MifepristoneDulaglutide may increase the hypoglycemic activities of Mifepristone.
MilnacipranMilnacipran may increase the hypoglycemic activities of Dulaglutide.
MinaprineMinaprine may increase the hypoglycemic activities of Dulaglutide.
MoclobemideMoclobemide may increase the hypoglycemic activities of Dulaglutide.
NateglinideDulaglutide may increase the hypoglycemic activities of Nateglinide.
NelfinavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Nelfinavir.
NiacinThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Niacin.
NialamideNialamide may increase the hypoglycemic activities of Dulaglutide.
NilotinibThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Nilotinib.
NorethisteroneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Norethisterone.
NorgestimateThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Norgestimate.
OctamoxinOctamoxin may increase the hypoglycemic activities of Dulaglutide.
OctreotideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Octreotide.
OctreotideDulaglutide may increase the hypoglycemic activities of Octreotide.
OlanzapineOlanzapine may increase the hypoglycemic activities of Dulaglutide.
OxandroloneOxandrolone may increase the hypoglycemic activities of Dulaglutide.
OxymetholoneOxymetholone may increase the hypoglycemic activities of Dulaglutide.
PaliperidoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Paliperidone.
PargylinePargyline may increase the hypoglycemic activities of Dulaglutide.
ParoxetineParoxetine may increase the hypoglycemic activities of Dulaglutide.
PasireotideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Pasireotide.
PasireotideDulaglutide may increase the hypoglycemic activities of Pasireotide.
PegvisomantPegvisomant may increase the hypoglycemic activities of Dulaglutide.
PentamidineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Pentamidine.
PentamidineDulaglutide may increase the hypoglycemic activities of Pentamidine.
PhenelzinePhenelzine may increase the hypoglycemic activities of Dulaglutide.
PheniprazinePheniprazine may increase the hypoglycemic activities of Dulaglutide.
PhenoxypropazinePhenoxypropazine may increase the hypoglycemic activities of Dulaglutide.
PiperazineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Piperazine.
PipotiazineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Pipotiazine.
PirlindolePirlindole may increase the hypoglycemic activities of Dulaglutide.
PivhydrazinePivhydrazine may increase the hypoglycemic activities of Dulaglutide.
PolythiazideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Polythiazide.
PrednisoloneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Prednisolone.
PrednisoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Prednisone.
ProgesteroneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Progesterone.
QuetiapineThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Quetiapine.
QuinethazoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Quinethazone.
QuinineDulaglutide may increase the hypoglycemic activities of Quinine.
RasagilineRasagiline may increase the hypoglycemic activities of Dulaglutide.
RepaglinideDulaglutide may increase the hypoglycemic activities of Repaglinide.
RisperidoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Risperidone.
RitonavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Ritonavir.
SafrazineSafrazine may increase the hypoglycemic activities of Dulaglutide.
Salicylic acidSalicylic acid may increase the hypoglycemic activities of Dulaglutide.
SaquinavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Saquinavir.
SelegilineSelegiline may increase the hypoglycemic activities of Dulaglutide.
SertralineSertraline may increase the hypoglycemic activities of Dulaglutide.
SirolimusThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Sirolimus.
StanozololStanozolol may increase the hypoglycemic activities of Dulaglutide.
SulfadiazineDulaglutide may increase the hypoglycemic activities of Sulfadiazine.
SulfamethoxazoleDulaglutide may increase the hypoglycemic activities of Sulfamethoxazole.
SulfisoxazoleDulaglutide may increase the hypoglycemic activities of Sulfisoxazole.
SunitinibDulaglutide may increase the hypoglycemic activities of Sunitinib.
TacrolimusThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Tacrolimus.
TemsirolimusThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Temsirolimus.
TestosteroneTestosterone may increase the hypoglycemic activities of Dulaglutide.
TipranavirThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Tipranavir.
TolazamideDulaglutide may increase the hypoglycemic activities of Tolazamide.
TolbutamideDulaglutide may increase the hypoglycemic activities of Tolbutamide.
ToloxatoneToloxatone may increase the hypoglycemic activities of Dulaglutide.
TorasemideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Torasemide.
Trans-2-PhenylcyclopropylamineTrans-2-Phenylcyclopropylamine may increase the hypoglycemic activities of Dulaglutide.
TranylcypromineTranylcypromine may increase the hypoglycemic activities of Dulaglutide.
TrazodoneTrazodone may increase the hypoglycemic activities of Dulaglutide.
TriamcinoloneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Triamcinolone.
TrichlormethiazideThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Trichlormethiazide.
TriptorelinThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Triptorelin.
VilazodoneVilazodone may increase the hypoglycemic activities of Dulaglutide.
VorinostatThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Vorinostat.
VortioxetineVortioxetine may increase the hypoglycemic activities of Dulaglutide.
ZimelidineZimelidine may increase the hypoglycemic activities of Dulaglutide.
ZiprasidoneThe therapeutic efficacy of Dulaglutide can be decreased when used in combination with Ziprasidone.
Food InteractionsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
agonist
General Function:
Transmembrane signaling receptor activity
Specific Function:
This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene Name:
GLP1R
Uniprot ID:
P43220
Molecular Weight:
53025.22 Da
References
  1. Sanford M: Dulaglutide: first global approval. Drugs. 2014 Nov;74(17):2097-103. doi: 10.1007/s40265-014-0320-7. [PubMed:25367716 ]
Comments
comments powered by Disqus
Drug created on April 29, 2015 12:08 / Updated on August 17, 2016 12:24