Reverse transcriptase/RNaseH

Details

Name
Reverse transcriptase/RNaseH
Synonyms
Not Available
Gene Name
pol
Organism
Human immunodeficiency virus 1
Amino acid sequence
>lcl|BSEQ0012880|Reverse transcriptase/RNaseH
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLRTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVLFLDGID
Number of residues
566
Molecular Weight
65223.615
Theoretical pI
8.45
GO Classification
Functions
nucleic acid binding / RNA-directed DNA polymerase activity / metal ion binding / identical protein binding / RNA-DNA hybrid ribonuclease activity
General Function
Rna-dna hybrid ribonuclease activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
Not Available
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ72547
UniProtKB Entry NameQ72547_9HIV1
GenBank Protein ID896047
GenBank Gene IDU28646
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00300Tenofovir disoproxilapproved, investigationalyesinhibitorDetails
DB079355-[(5-fluoro-3-methyl-1H-indazol-4-yl)oxy]benzene-1,3-dicarbonitrileexperimentalunknownDetails
DB01048Abacavirapproved, investigationalyesinhibitorDetails
DB00705DelavirdineapprovedyesinhibitorDetails
DB00900DidanosineapprovedyesinhibitorDetails
DB00625Efavirenzapproved, investigationalyesinhibitorDetails
DB00879Emtricitabineapproved, investigationalyesinhibitorDetails
DB00709Lamivudineapproved, investigationalyesinhibitorDetails
DB00238NevirapineapprovedyesinhibitorDetails
DB00649Stavudineapproved, investigationalyesinhibitorDetails
DB00943Zalcitabineapproved, investigationalyesinhibitorDetails
DB00495ZidovudineapprovedyesinhibitorDetails
DB08864RilpivirineapprovedyesinhibitorDetails
DB09299Tenofovir alafenamideapprovedyesinhibitorDetails
DB11365SennosidesapprovedunknowninhibitorDetails
DB11799Bictegravirapproved, investigationalyesantagonistDetails
DB12855ApricitabineinvestigationalunknowninhibitorDetails
DB12301Doravirineapproved, investigationalunknowninhibitorDetails