Histone deacetylase 8

Details

Name
Histone deacetylase 8
Synonyms
  • 3.5.1.98
  • HD8
  • HDACL1
Gene Name
HDAC8
Organism
Human
Amino acid sequence
>lcl|BSEQ0003191|Histone deacetylase 8
MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPK
VASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATI
TAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLH
HGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKY
YQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLI
LGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPH
RIQQILNYIKGNLKHVV
Number of residues
377
Molecular Weight
41757.29
Theoretical pI
5.37
GO Classification
Functions
transcription factor binding / NAD-dependent histone deacetylase activity (H3-K14 specific) / metal ion binding / histone deacetylase activity
Processes
transcription, DNA-templated / chromatin modification / chromatin organization / chromatin assembly or disassembly / sister chromatid cohesion / regulation of cohesin localization to chromatin / negative regulation of transcription from RNA polymerase II promoter / mitotic cell cycle
Components
cytoplasm / nucleus / plasma membrane / histone deacetylase complex / nuclear chromosome / cytosol / nucleoplasm
General Function
Transcription factor binding
Specific Function
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Also involved in the deacetylation of cohesin complex protein SMC3 regulating release of cohesin complexes from chromatin. May play a role in smooth muscle cell contractility.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Nucleus
Gene sequence
>lcl|BSEQ0016492|Histone deacetylase 8 (HDAC8)
ATGGAGGAGCCGGAGGAACCGGCGGACAGTGGGCAGTCGCTGGTCCCGGTTTATATCTAT
AGTCCCGAGTATGTCAGTATGTGTGACTCCCTGGCCAAGATCCCCAAACGGGCCAGTATG
GTGCATTCTTTGATTGAAGCATATGCACTGCATAAGCAGATGAGAGATGAAGCATCTGGT
TTTTGTTATCTCAATGATGCTGTCCTGGGAATATTACGATTGCGACGGAAATTTGAGCGT
ATTCTCTACGTGGATTTGGATCTGCACCATGGAGATGGTGTAGAAGACGCATTCAGTTTC
ACCTCCAAAGTCATGACCGTGTCCCTGCACAAATTCTCCCCAGGATTTTTCCCAGGAACA
GGTGACGTGTCTGATGTTGGCCTAGGGAAGGGACGGTACTACAGTGTAAATGTGCCCATT
CAGGATGGCATACAAGATGAAAAATATTACCAGATCTGTGAAAGTGTACTAAAGGAAGTA
TACCAAGCCTTTAATCCCAAAGCAGTGGTCTTACAGCTGGGAGCTGACACAATAGCTGGG
GATCCCATGTGCTCCTTTAACATGACTCCAGTGGGAATTGGCAAGTGTCTTAAGTACATC
CTTCAATGGCAGTTGGCAACACTCATTTTGGGAGGAGGAGGCTATAACCTTGCCAACACG
GCTCGATGCTGGACATACTTGACCGGGGTCATCCTAGGGAAAACACTATCCTCTGAGATC
CCAGATCATGAGTTTTTCACAGCATATGGTCCTGATTATGTGCTGGAAATCACGCCAAGC
TGCCGGCCAGACCGCAATGAGCCCCACCGAATCCAACAAATCCTCAACTACATCAAAGGG
AATCTGAAGCATGTGGTCTAG
Chromosome Location
X
Locus
Xq13
External Identifiers
ResourceLink
UniProtKB IDQ9BY41
UniProtKB Entry NameHDAC8_HUMAN
GenBank Protein ID8118721
GenBank Gene IDAF230097
GenAtlas IDHDAC8
HGNC IDHGNC:13315
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB025654-Dimethylamino-N-(6-Hydroxycarbamoyethyl)Benzamide-N-Hydroxy-7-(4-Dimethyla Minobenzoyl)AminoheptanamideexperimentalunknownDetails
DB02917N-Hydroxy-4-(Methyl{[5-(2-Pyridinyl)-2-Thienyl]Sulfonyl}Amino)BenzamideexperimentalunknownDetails
DB042977-[4-(Dimethylamino)Phenyl]-N-Hydroxy-4,6-Dimethyl-7-Oxo-2,4-HeptadienamideexperimentalunknownDetails
DB02546Vorinostatapproved, investigationalunknownDetails
DB07350(2E)-N-hydroxy-3-[1-methyl-4-(phenylacetyl)-1H-pyrrol-2-yl]prop-2-enamideexperimentalunknownDetails
DB075865-(4-METHYL-BENZOYLAMINO)-BIPHENYL-3,4'-DICARBOXYLIC ACID 3-DIMETHYLAMIDE-4'-HYDROXYAMIDEexperimentalunknownDetails
DB081687-AMINO-4-METHYL-CHROMEN-2-ONEexperimentalunknownDetails
DB01592IronapprovedunknowncofactorDetails
DB01593Zincapproved, investigationalunknowncofactorDetails
DB14487Zinc acetateapproved, investigationalunknownDetails
DB14488Ferrous gluconateapprovedunknownDetails
DB14489Ferrous succinateapprovedunknownDetails
DB14490Ferrous ascorbateapprovedunknownDetails
DB14491Ferrous fumarateapprovedunknownDetails
DB14501Ferrous glycine sulfateapprovedunknownDetails
DB14533Zinc chlorideapproved, investigationalunknownDetails
DB05015Belinostatapproved, investigationalyesinhibitorDetails
DB06603Panobinostatapproved, investigationalyesinhibitorDetails