You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameHyaluronidase
Accession NumberDB00070  (BTD00022, BIOD00022)
TypeBiotech
GroupsApproved, Investigational
DescriptionHighly purified sheep hyaluronidase for administration by injection into the vitreous of the eye.
Protein structureDb00070
Related Articles
Protein chemical formulaC2455H3775N617O704S21
Protein average weight53870.9 Da
Sequences
> Hyaluronidase Sequence
MWTGLGPAVTLALVLVVAWATELKPTAPPIFTGRPFVVAWDVPTQDCGPRHKMPLDPKDM
KAFDVQASPNEGFVNQNITIFYRDRLGMYPHFNSVGGSVHGGVPQNGSLWVHLEMLKGHV
EHYIRTQEPAGLAVIDWEDWRPVWVRNWQDKDVYRRLSRQLVASHHPDWPPERIVKEAQY
EFEFAARQFMLETLRFVKAFRPRHLWGFYLFPDCYNHDYVQNWETYTGRCPDVEVSRNDQ
LSWLWAESTALFPSVYLEETLASSTHGRNFVSFRVQEALRVADVHHANHALPVYVFTRPT
YSRGLTGLSEMDLISTIGESAALGAAGVILWGDAGFTTSNETCRRLKDYLTRSLVPYVVN
VSWAAQYCSWAQCHGHGRCVRRDPNAHTFLHLSASSFRLVPSHAPDEPRLRPEGELSWAD
RNHLQTHFRCQCYLGWGGEQCQWDRRRAAGGASGAWAGFHLTGLLAVAVLAFTWTS
Download FASTA Format
Synonyms
HYAL-1
Hyaluronidase (glycoprotein, sheep testis isoenzyme)
Hyaluronidase (ovine)
Hyaluronidase (sheep testis isoenzyme)
Hyaluronidase 1 precursor
Hyaluronidase PH-20
Hyaluronidase, ovine
Ovine hyaluronidase
Sperm adhesion molecule 1
Sperm surface protein PH-20
External Identifiers
  • HYO6A
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
AmphadaseInjection150 [USP'U]/mLSubcutaneousAmphastar Pharmaceuticals, Inc.2004-10-26Not applicableUs
HydaseInjection, solution150 [USP'U]/mLInfiltration; Interstitial; Intramuscular; Intraocular; Retrobulbar; SubcutaneousAkorn, Inc.2015-11-05Not applicableUs
VitraseInjection, solution200 [USP'U]/mLSubcutaneousBausch & Lomb Incorporated2005-02-01Not applicableUs
VitraseInjection, solution200 [USP'U]/mLSubcutaneousISTA Pharmaceuticals, Inc.2005-02-01Not applicableUs
Wydase Inj 150unit/mlLiquid150 unitInfiltration; SubcutaneousWyeth Ltd.1954-12-311996-09-10Canada
Wydase Injection Liq 150 Units/mlLiquid150 unitInfiltration; SubcutaneousWyeth Ayerst Canada Inc.1994-12-312002-06-10Canada
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International Brands
NameCompany
VitraganNot Available
Brand mixtures
NameLabellerIngredients
HyqviaBaxalta Us Inc.
SaltsNot Available
Categories
UNII64R4OHP8T0
CAS number488712-31-8
Pharmacology
IndicationFor increase of absorption and distribution of other injected drugs and for rehydration.
Structured Indications Not Available
PharmacodynamicsHyaluronidase hydrolyzes hyaluronic acid and increase diffusion of injected drugs, thus facilitating their absorption. Hyaluronidase is used for enhancing absorption and distribution of other injected drugs.
Mechanism of actionHyaluronidase is a spreading or diffusing substance. It increase the permeability of connective tissue through the hydrolysis of hyaluronic acid. Hyaluronidase hydrolyzes hyaluronic acid by splitting the glucosaminidic bond between C1 of the glucosamine moiety and C4 of glucuronic acid. This temporarily decreases the viscosity of the cellular cement and increases diffusion of injected fluids or of localized transudates or exudates, thus facilitating their absorption.
TargetKindPharmacological actionActionsOrganismUniProt ID
HyaluronanSmall moleculeyes
other
Humannot applicabledetails
Transforming growth factor beta-1Proteinunknown
inhibitor
HumanP01137 details
Related Articles
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
MetabolismNot Available
Route of eliminationNot Available
Half lifeNot Available
ClearanceNot Available
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Interactions
Drug Interactions
DrugInteractionDrug group
16-BromoepiandrosteroneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with 16-Bromoepiandrosterone.Investigational
19-norandrostenedioneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with 19-norandrostenedione.Experimental, Illicit
4-AndrostenedioneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with 4-Androstenedione.Experimental, Illicit
5-androstenedioneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with 5-androstenedione.Experimental, Illicit
Acetylsalicylic acidThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Acetylsalicylic acid.Approved, Vet Approved
AcrivastineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Acrivastine.Approved
AdrafinilHyaluronidase may increase the vasoconstricting activities of Adrafinil.Withdrawn
AlcaftadineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Alcaftadine.Approved
AlclometasoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Alclometasone.Approved
AldosteroneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Aldosterone.Experimental
AlimemazineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Alimemazine.Approved, Vet Approved
AlprazolamThe therapeutic efficacy of Alprazolam can be decreased when used in combination with Hyaluronidase.Approved, Illicit, Investigational
AmcinonideThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Amcinonide.Approved
Aminosalicylic AcidThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Aminosalicylic Acid.Approved
AmitrazHyaluronidase may increase the vasoconstricting activities of Amitraz.Vet Approved
AnecortaveThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Anecortave.Investigational
AnisodamineHyaluronidase may increase the vasoconstricting activities of Anisodamine.Investigational
AntazolineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Antazoline.Approved
ApraclonidineHyaluronidase may increase the vasoconstricting activities of Apraclonidine.Approved
ArticaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Articaine.Approved
AstemizoleThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Astemizole.Approved, Withdrawn
AzatadineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Azatadine.Approved
AzelastineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Azelastine.Approved
BalsalazideThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Balsalazide.Approved, Investigational
BazedoxifeneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Bazedoxifene.Approved, Investigational
BeclomethasoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Beclomethasone.Investigational
Beclomethasone dipropionateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Beclomethasone dipropionate.Approved, Investigational
BenzocaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Benzocaine.Approved
Benzyl alcoholThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Benzyl alcohol.Approved
BetamethasoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Betamethasone.Approved, Vet Approved
BrimonidineHyaluronidase may increase the vasoconstricting activities of Brimonidine.Approved
BromazepamThe therapeutic efficacy of Bromazepam can be decreased when used in combination with Hyaluronidase.Approved, Illicit
BrompheniramineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Brompheniramine.Approved
BuclizineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Buclizine.Approved
BudesonideThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Budesonide.Approved
BupivacaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Bupivacaine.Approved, Investigational
ButacaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Butacaine.Vet Approved
ButambenThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Butamben.Approved
Butanoic AcidThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Butanoic Acid.Experimental
CamazepamThe therapeutic efficacy of Camazepam can be decreased when used in combination with Hyaluronidase.Approved, Illicit
CapsaicinThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Capsaicin.Approved
CarbinoxamineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Carbinoxamine.Approved
CetirizineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Cetirizine.Approved
ChlordiazepoxideThe therapeutic efficacy of Chlordiazepoxide can be decreased when used in combination with Hyaluronidase.Approved, Illicit
ChloroprocaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Chloroprocaine.Approved
ChloropyramineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Chloropyramine.Approved
ChlorotrianiseneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Chlorotrianisene.Withdrawn
ChlorphenamineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Chlorphenamine.Approved
ChlorphenoxamineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Chlorphenoxamine.Withdrawn
CiclesonideThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Ciclesonide.Approved, Investigational
CimetidineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Cimetidine.Approved
CinchocaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Cinchocaine.Approved, Vet Approved
CinnarizineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Cinnarizine.Approved
CirazolineHyaluronidase may increase the vasoconstricting activities of Cirazoline.Experimental
ClemastineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Clemastine.Approved
ClobetasolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Clobetasol.Investigational
Clobetasol propionateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Clobetasol propionate.Approved
ClocortoloneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Clocortolone.Approved
ClonazepamThe therapeutic efficacy of Clonazepam can be decreased when used in combination with Hyaluronidase.Approved, Illicit
ClonidineHyaluronidase may increase the vasoconstricting activities of Clonidine.Approved
ClorazepateThe therapeutic efficacy of Clorazepate can be decreased when used in combination with Hyaluronidase.Approved, Illicit
CocaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Cocaine.Approved, Illicit
Conjugated Equine EstrogensThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Conjugated Equine Estrogens.Approved
Cortisone acetateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Cortisone acetate.Approved
CyclizineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Cyclizine.Approved
CyproheptadineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Cyproheptadine.Approved
dehydroepiandrosterone sulfateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with dehydroepiandrosterone sulfate.Investigational
DelorazepamThe therapeutic efficacy of Delorazepam can be decreased when used in combination with Hyaluronidase.Approved, Illicit
dersalazineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with dersalazine.Investigational
DesloratadineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Desloratadine.Approved, Investigational
DesoximetasoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Desoximetasone.Approved
Desoxycorticosterone acetateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Desoxycorticosterone acetate.Approved
Desoxycorticosterone PivalateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Desoxycorticosterone Pivalate.Experimental, Vet Approved
DetomidineHyaluronidase may increase the vasoconstricting activities of Detomidine.Vet Approved
DexamethasoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Dexamethasone.Approved, Investigational, Vet Approved
Dexamethasone isonicotinateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Dexamethasone isonicotinate.Vet Approved
DexbrompheniramineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Dexbrompheniramine.Approved
Dexchlorpheniramine maleateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Dexchlorpheniramine maleate.Approved
DexmedetomidineHyaluronidase may increase the vasoconstricting activities of Dexmedetomidine.Approved, Vet Approved
DiazepamThe therapeutic efficacy of Diazepam can be decreased when used in combination with Hyaluronidase.Approved, Illicit, Vet Approved
DienestrolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Dienestrol.Approved
DiethylstilbestrolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Diethylstilbestrol.Approved
DiflorasoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Diflorasone.Approved
DiflunisalThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Diflunisal.Approved
DifluocortoloneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Difluocortolone.Approved
DifluprednateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Difluprednate.Approved
DimenhydrinateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Dimenhydrinate.Approved
DimetindeneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Dimetindene.Approved
DimetotiazineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Dimetotiazine.Approved
DiphenhydramineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Diphenhydramine.Approved
DopamineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Dopamine.Approved
DoxepinThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Doxepin.Approved
DoxylamineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Doxylamine.Approved, Vet Approved
DyclonineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Dyclonine.Approved
EbastineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Ebastine.Investigational
EmedastineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Emedastine.Approved
EpinastineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Epinastine.Approved, Investigational
EpinephrineHyaluronidase may increase the vasoconstricting activities of Epinephrine.Approved, Vet Approved
EquileninThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Equilenin.Experimental
EquilinThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Equilin.Approved
ErgotamineHyaluronidase may increase the vasoconstricting activities of Ergotamine.Approved
EsmirtazapineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Esmirtazapine.Investigational
EstazolamThe therapeutic efficacy of Estazolam can be decreased when used in combination with Hyaluronidase.Approved, Illicit
EstradiolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Estradiol.Approved, Investigational, Vet Approved
EstriolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Estriol.Approved, Vet Approved
EstroneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Estrone.Approved
Estrone sulfateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Estrone sulfate.Approved
Ethinyl EstradiolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Ethinyl Estradiol.Approved
EthopropazineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Ethopropazine.Approved
EtidocaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Etidocaine.Approved
EtilefrineHyaluronidase may increase the vasoconstricting activities of Etilefrine.Withdrawn
EtizolamThe therapeutic efficacy of Etizolam can be decreased when used in combination with Hyaluronidase.Approved
FamotidineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Famotidine.Approved
FexofenadineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Fexofenadine.Approved
fluasteroneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with fluasterone.Investigational
FludiazepamThe therapeutic efficacy of Fludiazepam can be decreased when used in combination with Hyaluronidase.Approved, Illicit
FludrocortisoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Fludrocortisone.Approved
FlumazenilThe therapeutic efficacy of Flumazenil can be decreased when used in combination with Hyaluronidase.Approved
FlumethasoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Flumethasone.Approved, Vet Approved
FlunarizineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Flunarizine.Approved
FlunisolideThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Flunisolide.Approved, Investigational
FlunitrazepamThe therapeutic efficacy of Flunitrazepam can be decreased when used in combination with Hyaluronidase.Approved, Illicit
Fluocinolone AcetonideThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Fluocinolone Acetonide.Approved, Investigational, Vet Approved
FluocinonideThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Fluocinonide.Approved, Investigational
FluocortoloneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Fluocortolone.Approved, Withdrawn
FluorometholoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Fluorometholone.Approved
FluprednideneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Fluprednidene.Approved, Withdrawn
FluprednisoloneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Fluprednisolone.Approved
FlurandrenolideThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Flurandrenolide.Approved
FlurazepamThe therapeutic efficacy of Flurazepam can be decreased when used in combination with Hyaluronidase.Approved, Illicit
Fluticasone furoateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Fluticasone furoate.Approved
Fluticasone PropionateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Fluticasone Propionate.Approved
FormestaneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Formestane.Approved, Investigational, Withdrawn
FurosemideThe therapeutic efficacy of Furosemide can be decreased when used in combination with Hyaluronidase.Approved, Vet Approved
GenisteinThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Genistein.Investigational
GuanabenzHyaluronidase may increase the vasoconstricting activities of Guanabenz.Approved
GuanfacineHyaluronidase may increase the vasoconstricting activities of Guanfacine.Approved, Investigational
HE3286The therapeutic efficacy of Hyaluronidase can be decreased when used in combination with HE3286.Investigational
HexestrolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Hexestrol.Withdrawn
HydrocortisoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Hydrocortisone.Approved, Vet Approved
HydroxyzineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Hydroxyzine.Approved
IsothipendylThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Isothipendyl.Approved
IstaroximeThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Istaroxime.Investigational
Kct 0809The therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Kct 0809.Investigational
KetotifenThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Ketotifen.Approved
LevobupivacaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Levobupivacaine.Approved
LevocabastineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Levocabastine.Approved
LevocetirizineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Levocetirizine.Approved
LidocaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Lidocaine.Approved, Vet Approved
LodoxamideThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Lodoxamide.Approved
LofexidineHyaluronidase may increase the vasoconstricting activities of Lofexidine.Approved, Investigational
LoratadineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Loratadine.Approved
LorazepamThe therapeutic efficacy of Lorazepam can be decreased when used in combination with Hyaluronidase.Approved
ME-609The therapeutic efficacy of Hyaluronidase can be decreased when used in combination with ME-609.Investigational
MeclizineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Meclizine.Approved
MedetomidineHyaluronidase may increase the vasoconstricting activities of Medetomidine.Vet Approved
MedrysoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Medrysone.Approved
MelengestrolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Melengestrol.Vet Approved
MephentermineHyaluronidase may increase the vasoconstricting activities of Mephentermine.Approved
MepivacaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Mepivacaine.Approved, Vet Approved
MepyramineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Mepyramine.Approved, Vet Approved
MequitazineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Mequitazine.Approved
MesalazineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Mesalazine.Approved
MestranolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Mestranol.Approved
MetaraminolHyaluronidase may increase the vasoconstricting activities of Metaraminol.Approved, Investigational
MethallenestrilThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Methallenestril.Experimental
MethapyrileneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Methapyrilene.Withdrawn
MethoxamineHyaluronidase may increase the vasoconstricting activities of Methoxamine.Approved
MethyldopaHyaluronidase may increase the vasoconstricting activities of Methyldopa.Approved
MethylprednisoloneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Methylprednisolone.Approved, Vet Approved
MetiamideThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Metiamide.Experimental
MianserinThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Mianserin.Approved
MidazolamThe therapeutic efficacy of Midazolam can be decreased when used in combination with Hyaluronidase.Approved, Illicit
MidodrineHyaluronidase may increase the vasoconstricting activities of Midodrine.Approved
MirtazapineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Mirtazapine.Approved
MizolastineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Mizolastine.Investigational
MometasoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Mometasone.Approved, Vet Approved
NaphazolineHyaluronidase may increase the vasoconstricting activities of Naphazoline.Approved
NCX 1022The therapeutic efficacy of Hyaluronidase can be decreased when used in combination with NCX 1022.Investigational
NCX 4016The therapeutic efficacy of Hyaluronidase can be decreased when used in combination with NCX 4016.Investigational
NetazepideThe therapeutic efficacy of Netazepide can be decreased when used in combination with Hyaluronidase.Investigational
NitrazepamThe therapeutic efficacy of Nitrazepam can be decreased when used in combination with Hyaluronidase.Approved
NitroaspirinThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Nitroaspirin.Investigational
NizatidineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Nizatidine.Approved
NorepinephrineHyaluronidase may increase the vasoconstricting activities of Norepinephrine.Approved
Oleoyl estroneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Oleoyl estrone.Investigational
OlopatadineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Olopatadine.Approved
OlsalazineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Olsalazine.Approved
OxazepamThe therapeutic efficacy of Oxazepam can be decreased when used in combination with Hyaluronidase.Approved
OxetacaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Oxetacaine.Investigational
OxybuprocaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Oxybuprocaine.Approved
OxymetazolineHyaluronidase may increase the vasoconstricting activities of Oxymetazoline.Approved
ParamethasoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Paramethasone.Approved
PemirolastThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Pemirolast.Approved
Pf 00477736The therapeutic efficacy of Pf 00477736 can be decreased when used in combination with Hyaluronidase.Investigational
PhenindamineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Phenindamine.Approved
PheniramineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Pheniramine.Approved
PhenolThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Phenol.Approved, Experimental
PhenylephrineHyaluronidase may increase the vasoconstricting activities of Phenylephrine.Approved
PhenylpropanolamineHyaluronidase may increase the vasoconstricting activities of Phenylpropanolamine.Approved, Vet Approved, Withdrawn
PhenytoinThe therapeutic efficacy of Phenytoin can be decreased when used in combination with Hyaluronidase.Approved, Vet Approved
PirenzepineThe therapeutic efficacy of Pirenzepine can be decreased when used in combination with Hyaluronidase.Approved
Polyestradiol phosphateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Polyestradiol phosphate.Approved
PramocaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Pramocaine.Approved
PrasteroneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Prasterone.Approved, Nutraceutical
PrazepamThe therapeutic efficacy of Prazepam can be decreased when used in combination with Hyaluronidase.Approved, Illicit
PrednicarbateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Prednicarbate.Approved
PrednisoloneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Prednisolone.Approved, Vet Approved
PrednisoneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Prednisone.Approved, Vet Approved
PregnenoloneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Pregnenolone.Experimental
PrilocaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Prilocaine.Approved
ProcaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Procaine.Approved, Investigational, Vet Approved
PromestrieneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Promestriene.Investigational
PromethazineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Promethazine.Approved
ProparacaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Proparacaine.Approved, Vet Approved
PropoxycaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Propoxycaine.Approved
PSD502The risk or severity of adverse effects can be increased when Hyaluronidase is combined with PSD502.Investigational
QuinestrolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Quinestrol.Approved
RacepinephrineHyaluronidase may increase the vasoconstricting activities of Racepinephrine.Approved
RanitidineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Ranitidine.Approved
RilmenidineHyaluronidase may increase the vasoconstricting activities of Rilmenidine.Investigational
RimexoloneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Rimexolone.Approved
RomifidineHyaluronidase may increase the vasoconstricting activities of Romifidine.Vet Approved
RopivacaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Ropivacaine.Approved
Roxatidine acetateThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Roxatidine acetate.Approved
S EquolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with S Equol.Investigational
Salicylic acidThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Salicylic acid.Approved, Vet Approved
SecoisolariciresinolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Secoisolariciresinol.Investigational
Spaglumic AcidThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Spaglumic Acid.Approved
SynephrineHyaluronidase may increase the vasoconstricting activities of Synephrine.Experimental
Synthetic Conjugated Estrogens, AThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Synthetic Conjugated Estrogens, A.Approved
Synthetic Conjugated Estrogens, BThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Synthetic Conjugated Estrogens, B.Approved
TemazepamThe therapeutic efficacy of Temazepam can be decreased when used in combination with Hyaluronidase.Approved
TerfenadineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Terfenadine.Withdrawn
TesmilifeneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Tesmilifene.Investigational
TetracaineThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Tetracaine.Approved, Vet Approved
TetrodotoxinThe risk or severity of adverse effects can be increased when Hyaluronidase is combined with Tetrodotoxin.Investigational
ThonzylamineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Thonzylamine.Approved
TiboloneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Tibolone.Approved
TixocortolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Tixocortol.Approved
TizanidineHyaluronidase may increase the vasoconstricting activities of Tizanidine.Approved
TranilastThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Tranilast.Approved, Investigational
TriamcinoloneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Triamcinolone.Approved, Vet Approved
TriazolamThe therapeutic efficacy of Triazolam can be decreased when used in combination with Hyaluronidase.Approved
TripelennamineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Tripelennamine.Approved, Vet Approved
TriprolidineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Triprolidine.Approved
XylazineHyaluronidase may increase the vasoconstricting activities of Xylazine.Vet Approved
XylometazolineHyaluronidase may increase the vasoconstricting activities of Xylometazoline.Approved
ZeranolThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Zeranol.Vet Approved
Food InteractionsNot Available
References
Synthesis Reference

Yasuhiro Mima, Masaaki Yamada, “Preparation of human placental hyaluronidase.” U.S. Patent US3945889, issued October, 1957.

US3945889
General References
  1. Csoka AB, Scherer SW, Stern R: Expression analysis of six paralogous human hyaluronidase genes clustered on chromosomes 3p21 and 7q31. Genomics. 1999 Sep 15;60(3):356-61. [PubMed:10493834 ]
External Links
ATC CodesB06AA03
AHFS CodesNot Available
PDB Entries
FDA labelDownload (42.5 KB)
MSDSDownload (72.5 KB)
Pharmacoeconomics
Manufacturers
  • Amphastar pharmaceutical inc
  • Primapharm inc
  • Ista pharmaceuticals
  • Baxter healthcare corp anesthesia and critical care
Packagers
Dosage forms
FormRouteStrength
InjectionSubcutaneous150 [USP'U]/mL
Injection, solutionInfiltration; Interstitial; Intramuscular; Intraocular; Retrobulbar; Subcutaneous150 [USP'U]/mL
Kit
Injection, solutionSubcutaneous200 [USP'U]/mL
LiquidInfiltration; Subcutaneous150 unit
Prices
Unit descriptionCostUnit
Vitrasert 4.5 mg implant19200.0USD implant
Vitrase 6200 unit vial967.2USD vial
Hyaluronidase powder900.0USD g
Hylenex 150 unit/ml vial108.0USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
PatentsNot Available
Properties
StateLiquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.117Not Available
isoelectric point5.73Not Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Small molecule
Organism
Human
Pharmacological action
yes
Actions
other
Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
inhibitor
General Function:
Type iii transforming growth factor beta receptor binding
Specific Function:
Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiati...
Gene Name:
TGFB1
Uniprot ID:
P01137
Molecular Weight:
44340.685 Da
References
  1. Chang NS: Hyaluronidase activation of c-Jun N-terminal kinase is necessary for protection of L929 fibrosarcoma cells from staurosporine-mediated cell death. Biochem Biophys Res Commun. 2001 May 4;283(2):278-86. [PubMed:11327694 ]
  2. Locci P, Marinucci L, Lilli C, Martinese D, Becchetti E: Transforming growth factor beta 1-hyaluronic acid interaction. Cell Tissue Res. 1995 Aug;281(2):317-24. [PubMed:7648625 ]
  3. Chang NS: Hyaluronidase enhancement of TNF-mediated cell death is reversed by TGF-beta 1. Am J Physiol. 1997 Dec;273(6 Pt 1):C1987-94. [PubMed:9435505 ]
  4. Chang NS: Transforming growth factor-beta protection of cancer cells against tumor necrosis factor cytotoxicity is counteracted by hyaluronidase (review). Int J Mol Med. 1998 Dec;2(6):653-9. [PubMed:9850732 ]

Carriers

Kind
Protein
Organism
Human
Pharmacological action
unknown
Actions
inhibitor
General Function:
Toxic substance binding
Specific Function:
Serum albumin, the main protein of plasma, has a good binding capacity for water, Ca(2+), Na(+), K(+), fatty acids, hormones, bilirubin and drugs. Its main function is the regulation of the colloidal osmotic pressure of blood. Major zinc transporter in plasma, typically binds about 80% of all plasma zinc.
Gene Name:
ALB
Uniprot ID:
P02768
Molecular Weight:
69365.94 Da
References
  1. Maingonnat C, Victor R, Bertrand P, Courel MN, Maunoury R, Delpech B: Activation and inhibition of human cancer cell hyaluronidase by proteins. Anal Biochem. 1999 Mar 1;268(1):30-4. [PubMed:10036158 ]
  2. Parameswaran S, Brown LV, Ibbott GS, Lai-Fook SJ: Effect of concentration and hyaluronidase on albumin diffusion across rabbit mesentery. Microcirculation. 1999 Jun;6(2):117-26. [PubMed:10466114 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23