Identification

Name
Hyaluronidase
Accession Number
DB00070  (BTD00022, BIOD00022)
Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Other protein based therapies
Description

Highly purified sheep hyaluronidase for administration by injection into the vitreous of the eye.

Protein structure
Db00070
Protein chemical formula
C2455H3775N617O704S21
Protein average weight
53870.9 Da
Sequences
> Hyaluronidase Sequence
MWTGLGPAVTLALVLVVAWATELKPTAPPIFTGRPFVVAWDVPTQDCGPRHKMPLDPKDM
KAFDVQASPNEGFVNQNITIFYRDRLGMYPHFNSVGGSVHGGVPQNGSLWVHLEMLKGHV
EHYIRTQEPAGLAVIDWEDWRPVWVRNWQDKDVYRRLSRQLVASHHPDWPPERIVKEAQY
EFEFAARQFMLETLRFVKAFRPRHLWGFYLFPDCYNHDYVQNWETYTGRCPDVEVSRNDQ
LSWLWAESTALFPSVYLEETLASSTHGRNFVSFRVQEALRVADVHHANHALPVYVFTRPT
YSRGLTGLSEMDLISTIGESAALGAAGVILWGDAGFTTSNETCRRLKDYLTRSLVPYVVN
VSWAAQYCSWAQCHGHGRCVRRDPNAHTFLHLSASSFRLVPSHAPDEPRLRPEGELSWAD
RNHLQTHFRCQCYLGWGGEQCQWDRRRAAGGASGAWAGFHLTGLLAVAVLAFTWTS
Download FASTA Format
Synonyms
  • HYAL-1
  • Hyaluronidase (glycoprotein, sheep testis isoenzyme)
  • Hyaluronidase (ovine)
  • Hyaluronidase (sheep testis isoenzyme)
  • Hyaluronidase 1 precursor
  • Hyaluronidase PH-20
  • Hyaluronidase, ovine
  • Ovine hyaluronidase
  • Sperm adhesion molecule 1
  • Sperm surface protein PH-20
External IDs
HYO6A
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
AmphadaseInjection150 [USP'U]/1mLSubcutaneousAmphastar Pharmaceuticals, Inc.2004-10-26Not applicableUs
HydaseInjection, solution150 [USP'U]/1mLInfiltration; Interstitial; Intramuscular; Intraocular; Retrobulbar; SubcutaneousAkorn2015-11-05Not applicableUs
VitraseInjection, solution200 [USP'U]/1mLSubcutaneousBauch & Lomb Incorporated2005-02-01Not applicableUs
VitraseInjection, powder, lyophilized, for solution6200 [USP'U]/5mLSubcutaneousISTA PHARMACUTICALS, INC2004-07-012009-09-30Us
VitraseInjection, solution200 [USP'U]/1mLSubcutaneousIsta Pharmaceuticals, Inc2005-02-01Not applicableUs
Wydase Inj 150unit/mlLiquid150 unitInfiltration; SubcutaneousWyeth Ltd.1954-12-311996-09-10Canada
Wydase Injection Liq 150 Units/mlLiquid150 unitInfiltration; SubcutaneousWyeth Ayerst Canada Inc.1994-12-312002-06-10Canada
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing End
Rituxan HycelaHyaluronidase (2000 U/1mL) + Rituximab (120 mg/1mL)Injection, solutionSubcutaneousGenentech, Inc.2017-06-22Not applicableUs
Rituxan HycelaHyaluronidase (2000 U/1mL) + Rituximab (120 mg/1mL)Injection, solutionSubcutaneousGenentech, Inc.2017-06-22Not applicableUs
International/Other Brands
Vitragan
Categories
UNII
64R4OHP8T0
CAS number
488712-31-8

Pharmacology

Indication

For increase of absorption and distribution of other injected drugs and for rehydration.

Associated Conditions
Associated Therapies
Pharmacodynamics

Hyaluronidase hydrolyzes hyaluronic acid and increase diffusion of injected drugs, thus facilitating their absorption. Hyaluronidase is used for enhancing absorption and distribution of other injected drugs.

Mechanism of action

Hyaluronidase is a spreading or diffusing substance. It increase the permeability of connective tissue through the hydrolysis of hyaluronic acid. Hyaluronidase hydrolyzes hyaluronic acid by splitting the glucosaminidic bond between C1 of the glucosamine moiety and C4 of glucuronic acid. This temporarily decreases the viscosity of the cellular cement and increases diffusion of injected fluids or of localized transudates or exudates, thus facilitating their absorption.

TargetActionsOrganism
AHyaluronan
other
Human
UTransforming growth factor beta-1
inhibitor
Human
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half life
Not Available
Clearance
Not Available
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteraction
4-MethoxyamphetamineHyaluronidase may increase the vasoconstricting activities of 4-Methoxyamphetamine.
AceprometazineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Aceprometazine.
Acetylsalicylic acidThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Acetylsalicylic acid.
AcrivastineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Acrivastine.
AdinazolamThe therapeutic efficacy of Adinazolam can be decreased when used in combination with Hyaluronidase.
AdrafinilHyaluronidase may increase the vasoconstricting activities of Adrafinil.
AldosteroneThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Aldosterone.
AlimemazineThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Alimemazine.
AloxiprinThe therapeutic efficacy of Hyaluronidase can be decreased when used in combination with Aloxiprin.
AlprazolamThe therapeutic efficacy of Alprazolam can be decreased when used in combination with Hyaluronidase.
Food Interactions
Not Available

References

Synthesis Reference

Yasuhiro Mima, Masaaki Yamada, "Preparation of human placental hyaluronidase." U.S. Patent US3945889, issued October, 1957.

US3945889
General References
  1. Csoka AB, Scherer SW, Stern R: Expression analysis of six paralogous human hyaluronidase genes clustered on chromosomes 3p21 and 7q31. Genomics. 1999 Sep 15;60(3):356-61. [PubMed:10493834]
External Links
UniProt
P38567
Genbank
L13781
PubChem Substance
46505087
ChEMBL
CHEMBL1201636
PharmGKB
PA164745713
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Hyaluronidase
ATC Codes
B06AA03 — Hyaluronidase
FDA label
Download (42.5 KB)
MSDS
Download (72.5 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0Active Not RecruitingBasic ScienceDrug Safety1
0CompletedSupportive CareAddition of Hyalase to Local Anesthetic in Scalp Block1
0CompletedTreatmentDiabetes, Diabetes Mellitus Type 11
1CompletedNot AvailableDrug hypersensitivity reaction1
1CompletedScreeningDrug hypersensitivity reaction1
1CompletedTreatmentDermal Filler1
1CompletedTreatmentHealthy Volunteers1
1Not Yet RecruitingTreatmentMantle Cell Lymphoma (MCL)1
2CompletedScreeningAllergic Skin Reaction1
2CompletedTreatmentMultifocal Motor Neuropathy (MMN)1
2CompletedTreatmentRetinopathy, Diabetic / Vitreous Detachment1
2Enrolling by InvitationTreatmentDehydration1
2Not Yet RecruitingTreatmentCutaneous Melanoma, Stage III / Cutaneous Melanoma, Stage IV / Stage III Melanoma / Stage IIIA Skin Melanoma / Stage IIIB Skin Melanoma / Stage IIIC Skin Melanoma / Stage IV Skin Melanoma / Unresectable Melanoma1
2Not Yet RecruitingTreatmentMuscle Spasticity1
2RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL)1
2, 3CompletedTreatmentDiabetes, Diabetes Mellitus Type 11
3CompletedPreventionCardiovascular Disease (CVD) / Coronary Heart Disease (CHD) / Heart Diseases / Myocardial Infarction / Myocardial Ischemia1
3CompletedTreatmentPain NOS1
3CompletedTreatmentPrimary Immunodeficiency Diseases (PID)2
3CompletedTreatmentRetinopathy, Diabetic / Vitreous Hemorrhage2
3RecruitingPreventionPrimary Immunodeficiency Diseases (PID)1
3RecruitingTreatmentPolyradiculoneuropathy, Chronic Inflammatory Demyelinating2
4CompletedTreatmentCardiac Dysrhythmia1
4RecruitingTreatmentCongenital Immunodeficiency1
4RecruitingTreatmentPrimary Immunodeficiency Diseases (PID)1
Not AvailableActive Not RecruitingNot AvailableExposure During Pregnancy1
Not AvailableCompletedSupportive CareNalbuphine as an Adjuvant to L. A in Peribulbar Block for Cataract Surgery1
Not AvailableNot Yet RecruitingDiagnosticIntraocular Pressure Low1
Not AvailableNot Yet RecruitingTreatmentMultifocal Motor Neuropathy (MMN)1
Not AvailableRecruitingNot AvailableCongenital Immunodeficiency / Secondary Immune Deficiency1
Not AvailableRecruitingNot AvailablePrimary Immunodeficiency Diseases (PID)1
Not AvailableRecruitingPreventionPostoperative pain1
Not AvailableRecruitingTreatmentTreatment Resistant Carpal Tunnel in RA Patients1
Not AvailableWithdrawnTreatmentUpper Eyelid Surgery1

Pharmacoeconomics

Manufacturers
  • Amphastar pharmaceutical inc
  • Primapharm inc
  • Ista pharmaceuticals
  • Baxter healthcare corp anesthesia and critical care
Packagers
  • Akorn Inc.
  • Amphastar Pharmaceuticals
  • Bausch & Lomb Inc.
  • Baxter International Inc.
  • Cardinal Health
  • Halozyme Therapeutics Inc.
  • ISTA Pharmaceuticals
  • Oso Biopharmaceuticals Manufacturing LLC
  • Primapharm Inc.
  • Professional Co.
Dosage forms
FormRouteStrength
InjectionSubcutaneous150 [USP'U]/1mL
Injection, solutionInfiltration; Interstitial; Intramuscular; Intraocular; Retrobulbar; Subcutaneous150 [USP'U]/1mL
Injection, solutionSubcutaneous
Injection, powder, lyophilized, for solutionSubcutaneous6200 [USP'U]/5mL
Injection, solutionSubcutaneous200 [USP'U]/1mL
LiquidInfiltration; Subcutaneous150 unit
Prices
Unit descriptionCostUnit
Vitrasert 4.5 mg implant19200.0USD implant
Vitrase 6200 unit vial967.2USD vial
Hyaluronidase powder900.0USD g
Hylenex 150 unit/ml vial108.0USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Not Available

Properties

State
Liquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.117Not Available
isoelectric point5.73Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Small molecule
Organism
Human
Pharmacological action
Yes
Actions
Other
Kind
Protein
Organism
Human
Pharmacological action
Unknown
Actions
Inhibitor
General Function
Type iii transforming growth factor beta receptor binding
Specific Function
Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negati...
Gene Name
TGFB1
Uniprot ID
P01137
Uniprot Name
Transforming growth factor beta-1
Molecular Weight
44340.685 Da
References
  1. Chang NS: Hyaluronidase activation of c-Jun N-terminal kinase is necessary for protection of L929 fibrosarcoma cells from staurosporine-mediated cell death. Biochem Biophys Res Commun. 2001 May 4;283(2):278-86. [PubMed:11327694]
  2. Locci P, Marinucci L, Lilli C, Martinese D, Becchetti E: Transforming growth factor beta 1-hyaluronic acid interaction. Cell Tissue Res. 1995 Aug;281(2):317-24. [PubMed:7648625]
  3. Chang NS: Hyaluronidase enhancement of TNF-mediated cell death is reversed by TGF-beta 1. Am J Physiol. 1997 Dec;273(6 Pt 1):C1987-94. [PubMed:9435505]
  4. Chang NS: Transforming growth factor-beta protection of cancer cells against tumor necrosis factor cytotoxicity is counteracted by hyaluronidase (review). Int J Mol Med. 1998 Dec;2(6):653-9. [PubMed:9850732]

Carriers

Kind
Protein
Organism
Human
Pharmacological action
Unknown
Actions
Inhibitor
General Function
Toxic substance binding
Specific Function
Serum albumin, the main protein of plasma, has a good binding capacity for water, Ca(2+), Na(+), K(+), fatty acids, hormones, bilirubin and drugs. Its main function is the regulation of the colloid...
Gene Name
ALB
Uniprot ID
P02768
Uniprot Name
Serum albumin
Molecular Weight
69365.94 Da
References
  1. Maingonnat C, Victor R, Bertrand P, Courel MN, Maunoury R, Delpech B: Activation and inhibition of human cancer cell hyaluronidase by proteins. Anal Biochem. 1999 Mar 1;268(1):30-4. [PubMed:10036158]
  2. Parameswaran S, Brown LV, Ibbott GS, Lai-Fook SJ: Effect of concentration and hyaluronidase on albumin diffusion across rabbit mesentery. Microcirculation. 1999 Jun;6(2):117-26. [PubMed:10466114]

Drug created on June 13, 2005 07:24 / Updated on December 01, 2018 19:13