Identification

Name
Rituximab
Accession Number
DB00073  (BTD00014, BIOD00014)
Type
Biotech
Groups
Approved
Description

Rituxan is a genetically engineered chimeric murine/human monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes. The antibody is an IgG1 kappa immunoglobulin containing murine light- and heavy-chain variable region sequences and human constant region sequences. Rituximab is composed of two heavy chains of 451 amino acids and two light chains of 213 amino acids

Protein structure
Db00073
Protein chemical formula
C6416H9874N1688O1987S44
Protein average weight
143859.7 Da
Sequences
>Rituximab heavy chain chimeric
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSY
NQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVS
AASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKAEPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>Rituximab light chain chimeric
QIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVR
FSGSGSGTSYSLTISRVEAEDAATYYCQQWTSNPPTFGGGTKLEIKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Download FASTA Format
Synonyms
  • AntiCD20
External IDs
IDEC-C2B8
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
RituxanSolution10 mgIntravenousHoffmann La Roche2000-03-20Not applicableCanada
RituxanInjection, solution10 mg/mLIntravenousGenentech, Inc.1997-11-26Not applicableUs
RituxanInjection, solution10 mg/mLIntravenousGenentech, Inc.1997-11-26Not applicableUs
Rituxan ScSolution120 mgSubcutaneousHoffmann La Roche2016-11-22Not applicableCanada
International/Other Brands
MabThera (Roche)
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing End
Rituxan HycelaRituximab (120 mg/mL) + Hyaluronidase (2000 U/mL)Injection, solutionSubcutaneousGenentech, Inc.2017-06-22Not applicableUs
Rituxan HycelaRituximab (120 mg/mL) + Hyaluronidase (2000 U/mL)Injection, solutionSubcutaneousGenentech, Inc.2017-06-22Not applicableUs
Categories
UNII
4F4X42SYQ6
CAS number
174722-31-7

Pharmacology

Indication

For treatment of CD20-positive non-Hodgkins lymphoma, chronic lymphocytic leukemia, and rheumatoid arthritis.

Structured Indications
Not Available
Pharmacodynamics

Rituximab binds to the CD20 antigen, which is predominantly expressed on mature B cells and on >90% of B-cell non-Hodgkin's lympohomas. The antibody leads to selective killing of B-cells.

Mechanism of action

The Fab regions of rituximab binds to the CD20 antigen on B lymphocytes, while the Fc domain recruits antibodies and complements to mediate cell lysis.

TargetActionsOrganism
ULow affinity immunoglobulin gamma Fc region receptor III-BNot AvailableHuman
UComplement C1r subcomponentNot AvailableHuman
UComplement C1q subcomponent subunit ANot AvailableHuman
UComplement C1q subcomponent subunit BNot AvailableHuman
UComplement C1q subcomponent subunit CNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor III-ANot AvailableHuman
UComplement C1s subcomponentNot AvailableHuman
UHigh affinity immunoglobulin gamma Fc receptor INot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-aNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-bNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-cNot AvailableHuman
AB-lymphocyte antigen CD20
antibody
Human
Absorption
Not Available
Volume of distribution
  • 3.1 L
Protein binding
Not Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system when bound to B lymphocytes, or by human antimurine antibody production

Route of elimination
Not Available
Half life

0.8 hours (mammalian reticulocytes, in vitro)

Clearance
  • 0.34 L/day [RA patients]
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Interacting Gene/EnzymeAllele nameGenotype(s)Defining Change(s)Type(s)DescriptionDetails
Low affinity immunoglobulin gamma Fc region receptor III-AFCGR3A(G;G) / (G;T)---Effect Directly StudiedPatients with this genotype have increased frequency of anti-tumor response when using rituximab to treat diffuse large B-cell lymphoma, follicular lymphoma, or [follicular non-Hodgkin lymphoma].Details

Interactions

Drug Interactions
DrugInteractionDrug group
AbataceptThe risk or severity of adverse effects can be increased when Rituximab is combined with Abatacept.Approved
AcebutololAcebutolol may increase the hypotensive activities of Rituximab.Approved
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Rituximab.Approved
AcetyldigoxinAcetyldigoxin may decrease the cardiotoxic activities of Rituximab.Experimental
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Rituximab.Approved
AliskirenAliskiren may increase the hypotensive activities of Rituximab.Approved, Investigational
AlprenololAlprenolol may increase the hypotensive activities of Rituximab.Approved, Withdrawn
AmbrisentanAmbrisentan may increase the hypotensive activities of Rituximab.Approved, Investigational
AmlodipineAmlodipine may increase the hypotensive activities of Rituximab.Approved
AnakinraThe risk or severity of adverse effects can be increased when Anakinra is combined with Rituximab.Approved
AtenololAtenolol may increase the hypotensive activities of Rituximab.Approved
BCG vaccineThe therapeutic efficacy of BCG vaccine can be decreased when used in combination with Rituximab.Investigational
BelimumabThe risk or severity of adverse effects can be increased when Rituximab is combined with Belimumab.Approved
BenazeprilBenazepril may increase the hypotensive activities of Rituximab.Approved, Investigational
BendroflumethiazideBendroflumethiazide may increase the hypotensive activities of Rituximab.Approved
BepridilBepridil may increase the hypotensive activities of Rituximab.Approved, Withdrawn
BetaxololBetaxolol may increase the hypotensive activities of Rituximab.Approved
BethanidineBethanidine may increase the hypotensive activities of Rituximab.Approved
BevacizumabBevacizumab may increase the cardiotoxic activities of Rituximab.Approved, Investigational
BietaserpineBietaserpine may increase the hypotensive activities of Rituximab.Experimental
BimatoprostBimatoprost may increase the hypotensive activities of Rituximab.Approved, Investigational
BisoprololBisoprolol may increase the hypotensive activities of Rituximab.Approved
BosentanBosentan may increase the hypotensive activities of Rituximab.Approved, Investigational
BQ-123BQ-123 may increase the hypotensive activities of Rituximab.Investigational
BretyliumBretylium may increase the hypotensive activities of Rituximab.Approved
BrimonidineBrimonidine may increase the hypotensive activities of Rituximab.Approved
BupranololBupranolol may increase the hypotensive activities of Rituximab.Approved
CabazitaxelThe risk or severity of adverse effects can be increased when Cabazitaxel is combined with Rituximab.Approved
CadralazineCadralazine may increase the hypotensive activities of Rituximab.Experimental
CafedrineCafedrine may increase the hypotensive activities of Rituximab.Investigational
CandesartanCandesartan may increase the hypotensive activities of Rituximab.Approved
CandoxatrilCandoxatril may increase the hypotensive activities of Rituximab.Experimental
CaptoprilCaptopril may increase the hypotensive activities of Rituximab.Approved
CarteololCarteolol may increase the hypotensive activities of Rituximab.Approved
CarvedilolCarvedilol may increase the hypotensive activities of Rituximab.Approved, Investigational
CeliprololCeliprolol may increase the hypotensive activities of Rituximab.Approved, Investigational
Certolizumab pegolRituximab may increase the immunosuppressive activities of Certolizumab pegol.Approved
ChlorothiazideChlorothiazide may increase the hypotensive activities of Rituximab.Approved, Vet Approved
ChlorthalidoneChlorthalidone may increase the hypotensive activities of Rituximab.Approved
CicletanineCicletanine may increase the hypotensive activities of Rituximab.Investigational
CilazaprilCilazapril may increase the hypotensive activities of Rituximab.Approved
ClonidineClonidine may increase the hypotensive activities of Rituximab.Approved
CloranololCloranolol may increase the hypotensive activities of Rituximab.Experimental
Clostridium tetani toxoid antigen (formaldehyde inactivated)The therapeutic efficacy of Clostridium tetani toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Rituximab.Approved
ClozapineThe risk or severity of adverse effects can be increased when Rituximab is combined with Clozapine.Approved
Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated)The therapeutic efficacy of Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Rituximab.Approved
CryptenamineCryptenamine may increase the hypotensive activities of Rituximab.Approved
CyclopenthiazideCyclopenthiazide may increase the hypotensive activities of Rituximab.Experimental
CyclophosphamideCyclophosphamide may increase the cardiotoxic activities of Rituximab.Approved, Investigational
CyclothiazideCyclothiazide may increase the hypotensive activities of Rituximab.Approved
CymarinCymarin may decrease the cardiotoxic activities of Rituximab.Experimental
DebrisoquinDebrisoquin may increase the hypotensive activities of Rituximab.Approved
DelaprilDelapril may increase the hypotensive activities of Rituximab.Experimental
DenosumabThe risk or severity of adverse effects can be increased when Denosumab is combined with Rituximab.Approved
DeserpidineDeserpidine may increase the hypotensive activities of Rituximab.Approved
DeslanosideDeslanoside may decrease the cardiotoxic activities of Rituximab.Approved
DiazoxideDiazoxide may increase the hypotensive activities of Rituximab.Approved
diethylnorsperminediethylnorspermine may increase the hypotensive activities of Rituximab.Investigational
DigitoxinDigitoxin may decrease the cardiotoxic activities of Rituximab.Approved
DigoxinDigoxin may decrease the cardiotoxic activities of Rituximab.Approved
DihydralazineDihydralazine may increase the hypotensive activities of Rituximab.Investigational
DiltiazemDiltiazem may increase the hypotensive activities of Rituximab.Approved
DocetaxelThe risk or severity of adverse effects can be increased when Docetaxel is combined with Rituximab.Approved, Investigational
DorzolamideDorzolamide may increase the hypotensive activities of Rituximab.Approved
DoxazosinDoxazosin may increase the hypotensive activities of Rituximab.Approved
EfonidipineEfonidipine may increase the hypotensive activities of Rituximab.Approved
EnalaprilEnalapril may increase the hypotensive activities of Rituximab.Approved, Vet Approved
EnalaprilatEnalaprilat may increase the hypotensive activities of Rituximab.Approved
EndralazineEndralazine may increase the hypotensive activities of Rituximab.Experimental
EpanololEpanolol may increase the hypotensive activities of Rituximab.Experimental
EpoprostenolEpoprostenol may increase the hypotensive activities of Rituximab.Approved
EprosartanEprosartan may increase the hypotensive activities of Rituximab.Approved
EtanerceptThe risk or severity of adverse effects can be increased when Etanercept is combined with Rituximab.Approved, Investigational
FelodipineFelodipine may increase the hypotensive activities of Rituximab.Approved, Investigational
FenoldopamFenoldopam may increase the hypotensive activities of Rituximab.Approved
Ferulic acidFerulic acid may increase the hypotensive activities of Rituximab.Experimental
FingolimodRituximab may increase the immunosuppressive activities of Fingolimod.Approved, Investigational
FosinoprilFosinopril may increase the hypotensive activities of Rituximab.Approved
G17DTThe therapeutic efficacy of G17DT can be decreased when used in combination with Rituximab.Investigational
GI-5005The therapeutic efficacy of GI-5005 can be decreased when used in combination with Rituximab.Investigational
GitoformateGitoformate may decrease the cardiotoxic activities of Rituximab.Experimental
GolimumabThe risk or severity of adverse effects can be increased when Golimumab is combined with Rituximab.Approved
GuanabenzGuanabenz may increase the hypotensive activities of Rituximab.Approved
GuanadrelGuanadrel may increase the hypotensive activities of Rituximab.Approved
GuanazodineGuanazodine may increase the hypotensive activities of Rituximab.Experimental
GuanethidineGuanethidine may increase the hypotensive activities of Rituximab.Approved
GuanfacineGuanfacine may increase the hypotensive activities of Rituximab.Approved, Investigational
GuanoclorGuanoclor may increase the hypotensive activities of Rituximab.Experimental
GuanoxabenzGuanoxabenz may increase the hypotensive activities of Rituximab.Experimental
GuanoxanGuanoxan may increase the hypotensive activities of Rituximab.Experimental
HexamethoniumHexamethonium may increase the hypotensive activities of Rituximab.Experimental
HydralazineHydralazine may increase the hypotensive activities of Rituximab.Approved
HydrochlorothiazideHydrochlorothiazide may increase the hypotensive activities of Rituximab.Approved, Vet Approved
HydroflumethiazideHydroflumethiazide may increase the hypotensive activities of Rituximab.Approved
ImidaprilImidapril may increase the hypotensive activities of Rituximab.Investigational
IndapamideIndapamide may increase the hypotensive activities of Rituximab.Approved
IndenololIndenolol may increase the hypotensive activities of Rituximab.Withdrawn
IndoraminIndoramin may increase the hypotensive activities of Rituximab.Withdrawn
InfliximabThe risk or severity of adverse effects can be increased when Infliximab is combined with Rituximab.Approved
INGN 201The therapeutic efficacy of INGN 201 can be decreased when used in combination with Rituximab.Investigational
INGN 225The therapeutic efficacy of INGN 225 can be decreased when used in combination with Rituximab.Investigational
IrbesartanIrbesartan may increase the hypotensive activities of Rituximab.Approved, Investigational
IsradipineIsradipine may increase the hypotensive activities of Rituximab.Approved
KetanserinKetanserin may increase the hypotensive activities of Rituximab.Investigational
LabetalolLabetalol may increase the hypotensive activities of Rituximab.Approved
LacidipineLacidipine may increase the hypotensive activities of Rituximab.Approved
Lanatoside CLanatoside C may decrease the cardiotoxic activities of Rituximab.Experimental
LatanoprostLatanoprost may increase the hypotensive activities of Rituximab.Approved, Investigational
LeflunomideThe risk or severity of adverse effects can be increased when Rituximab is combined with Leflunomide.Approved, Investigational
LercanidipineLercanidipine may increase the hypotensive activities of Rituximab.Approved, Investigational
LinsidomineLinsidomine may increase the hypotensive activities of Rituximab.Experimental
LisinoprilLisinopril may increase the hypotensive activities of Rituximab.Approved, Investigational
LofexidineLofexidine may increase the hypotensive activities of Rituximab.Approved, Investigational
LosartanLosartan may increase the hypotensive activities of Rituximab.Approved
MacitentanMacitentan may increase the hypotensive activities of Rituximab.Approved
ManidipineManidipine may increase the hypotensive activities of Rituximab.Approved
MecamylamineMecamylamine may increase the hypotensive activities of Rituximab.Approved
MetamizoleThe risk or severity of adverse effects can be increased when Metamizole is combined with Rituximab.Withdrawn
MethoserpidineMethoserpidine may increase the hypotensive activities of Rituximab.Experimental
MethyldopaMethyldopa may increase the hypotensive activities of Rituximab.Approved
MetildigoxinMetildigoxin may decrease the cardiotoxic activities of Rituximab.Experimental
MetipranololMetipranolol may increase the hypotensive activities of Rituximab.Approved
MetolazoneMetolazone may increase the hypotensive activities of Rituximab.Approved
MetoprololMetoprolol may increase the hypotensive activities of Rituximab.Approved, Investigational
MetyrosineMetyrosine may increase the hypotensive activities of Rituximab.Approved
MibefradilMibefradil may increase the hypotensive activities of Rituximab.Withdrawn
MinoxidilMinoxidil may increase the hypotensive activities of Rituximab.Approved
MoexiprilMoexipril may increase the hypotensive activities of Rituximab.Approved
MoxonidineMoxonidine may increase the hypotensive activities of Rituximab.Approved
MuzolimineMuzolimine may increase the hypotensive activities of Rituximab.Experimental
NadololNadolol may increase the hypotensive activities of Rituximab.Approved
NaftopidilNaftopidil may increase the hypotensive activities of Rituximab.Investigational
NatalizumabThe risk or severity of adverse effects can be increased when Rituximab is combined with Natalizumab.Approved, Investigational
NebivololNebivolol may increase the hypotensive activities of Rituximab.Approved, Investigational
NicardipineNicardipine may increase the hypotensive activities of Rituximab.Approved
NicorandilNicorandil may increase the hypotensive activities of Rituximab.Approved
NiguldipineNiguldipine may increase the hypotensive activities of Rituximab.Experimental
NilvadipineNilvadipine may increase the hypotensive activities of Rituximab.Approved
NimodipineNimodipine may increase the hypotensive activities of Rituximab.Approved
NisoldipineNisoldipine may increase the hypotensive activities of Rituximab.Approved
NitrendipineNitrendipine may increase the hypotensive activities of Rituximab.Approved
NitroprussideNitroprusside may increase the hypotensive activities of Rituximab.Approved
OleandrinOleandrin may decrease the cardiotoxic activities of Rituximab.Experimental
OlmesartanOlmesartan may increase the hypotensive activities of Rituximab.Approved, Investigational
OmapatrilatOmapatrilat may increase the hypotensive activities of Rituximab.Investigational
OuabainOuabain may decrease the cardiotoxic activities of Rituximab.Approved
OxprenololOxprenolol may increase the hypotensive activities of Rituximab.Approved
PaclitaxelThe risk or severity of adverse effects can be increased when Paclitaxel is combined with Rituximab.Approved, Vet Approved
PargylinePargyline may increase the hypotensive activities of Rituximab.Approved
PenbutololPenbutolol may increase the hypotensive activities of Rituximab.Approved, Investigational
PentoliniumPentolinium may increase the hypotensive activities of Rituximab.Approved
PerindoprilPerindopril may increase the hypotensive activities of Rituximab.Approved
PeruvosidePeruvoside may decrease the cardiotoxic activities of Rituximab.Experimental
PhenoxybenzaminePhenoxybenzamine may increase the hypotensive activities of Rituximab.Approved
PhentolaminePhentolamine may increase the hypotensive activities of Rituximab.Approved
PimecrolimusThe risk or severity of adverse effects can be increased when Pimecrolimus is combined with Rituximab.Approved, Investigational
PinacidilPinacidil may increase the hypotensive activities of Rituximab.Withdrawn
PindololPindolol may increase the hypotensive activities of Rituximab.Approved
PolythiazidePolythiazide may increase the hypotensive activities of Rituximab.Approved
PrazosinPrazosin may increase the hypotensive activities of Rituximab.Approved
PropranololPropranolol may increase the hypotensive activities of Rituximab.Approved, Investigational
ProscillaridinProscillaridin may decrease the cardiotoxic activities of Rituximab.Experimental
QuinaprilQuinapril may increase the hypotensive activities of Rituximab.Approved, Investigational
Rabies virus inactivated antigen, AThe therapeutic efficacy of Rabies virus inactivated antigen, A can be decreased when used in combination with Rituximab.Approved
RamiprilRamipril may increase the hypotensive activities of Rituximab.Approved
RemikirenRemikiren may increase the hypotensive activities of Rituximab.Approved
RescinnamineRescinnamine may increase the hypotensive activities of Rituximab.Approved
ReserpineReserpine may increase the hypotensive activities of Rituximab.Approved
RilmenidineRilmenidine may increase the hypotensive activities of Rituximab.Investigational
RindopepimutThe therapeutic efficacy of Rindopepimut can be decreased when used in combination with Rituximab.Investigational
RiociguatRiociguat may increase the hypotensive activities of Rituximab.Approved
RoflumilastRoflumilast may increase the immunosuppressive activities of Rituximab.Approved
Rotavirus VaccineThe therapeutic efficacy of Rotavirus Vaccine can be decreased when used in combination with Rituximab.Approved
Rubella virus vaccineThe therapeutic efficacy of Rubella virus vaccine can be decreased when used in combination with Rituximab.Approved
SaprisartanSaprisartan may increase the hypotensive activities of Rituximab.Experimental
SelexipagSelexipag may increase the hypotensive activities of Rituximab.Approved
Sipuleucel-TThe therapeutic efficacy of Sipuleucel-T can be decreased when used in combination with Rituximab.Approved
SitaxentanSitaxentan may increase the hypotensive activities of Rituximab.Approved, Investigational, Withdrawn
SpiraprilSpirapril may increase the hypotensive activities of Rituximab.Approved
SRP 299The therapeutic efficacy of SRP 299 can be decreased when used in combination with Rituximab.Investigational
TacrolimusThe risk or severity of adverse effects can be increased when Tacrolimus is combined with Rituximab.Approved, Investigational
TalinololTalinolol may increase the hypotensive activities of Rituximab.Investigational
TecemotideThe therapeutic efficacy of Tecemotide can be decreased when used in combination with Rituximab.Investigational
TelmisartanTelmisartan may increase the hypotensive activities of Rituximab.Approved, Investigational
TemocaprilTemocapril may increase the hypotensive activities of Rituximab.Experimental, Investigational
TerlipressinTerlipressin may increase the hypotensive activities of Rituximab.Approved, Investigational
TetrahydropalmatineTetrahydropalmatine may increase the hypotensive activities of Rituximab.Investigational
TG4010The therapeutic efficacy of TG4010 can be decreased when used in combination with Rituximab.Investigational
TheodrenalineTheodrenaline may increase the hypotensive activities of Rituximab.Investigational
TiboloneTibolone may increase the hypotensive activities of Rituximab.Approved
TicrynafenTicrynafen may increase the hypotensive activities of Rituximab.Withdrawn
TimololTimolol may increase the hypotensive activities of Rituximab.Approved
TocilizumabThe risk or severity of adverse effects can be increased when Rituximab is combined with Tocilizumab.Approved
TofacitinibThe risk or severity of adverse effects can be increased when Rituximab is combined with Tofacitinib.Approved, Investigational
TolazolineTolazoline may increase the hypotensive activities of Rituximab.Approved, Vet Approved
TolonidineTolonidine may increase the hypotensive activities of Rituximab.Experimental
TorasemideTorasemide may increase the hypotensive activities of Rituximab.Approved
TrandolaprilTrandolapril may increase the hypotensive activities of Rituximab.Approved
TrastuzumabTrastuzumab may increase the cardiotoxic activities of Rituximab.Approved, Investigational
TravoprostTravoprost may increase the hypotensive activities of Rituximab.Approved
TreprostinilTreprostinil may increase the hypotensive activities of Rituximab.Approved, Investigational
TrichlormethiazideTrichlormethiazide may increase the hypotensive activities of Rituximab.Approved, Vet Approved
TrimazosinTrimazosin may increase the hypotensive activities of Rituximab.Experimental
TrimethaphanTrimethaphan may increase the hypotensive activities of Rituximab.Approved
UnoprostoneUnoprostone may increase the hypotensive activities of Rituximab.Approved
UrapidilUrapidil may increase the hypotensive activities of Rituximab.Investigational
ValsartanValsartan may increase the hypotensive activities of Rituximab.Approved, Investigational
VincamineVincamine may increase the hypotensive activities of Rituximab.Experimental
VinpocetineVinpocetine may increase the hypotensive activities of Rituximab.Investigational
XipamideXipamide may increase the hypotensive activities of Rituximab.Experimental
XylometazolineXylometazoline may increase the hypotensive activities of Rituximab.Approved
Yellow fever vaccineThe therapeutic efficacy of Yellow fever vaccine can be decreased when used in combination with Rituximab.Approved
ZofenoprilZofenopril may increase the hypotensive activities of Rituximab.Experimental
Zoster vaccineThe therapeutic efficacy of Zoster vaccine can be decreased when used in combination with Rituximab.Approved
Food Interactions
Not Available

References

Synthesis Reference
Not Available
General References
  1. McLaughlin P, Grillo-Lopez AJ, Link BK, Levy R, Czuczman MS, Williams ME, Heyman MR, Bence-Bruckler I, White CA, Cabanillas F, Jain V, Ho AD, Lister J, Wey K, Shen D, Dallaire BK: Rituximab chimeric anti-CD20 monoclonal antibody therapy for relapsed indolent lymphoma: half of patients respond to a four-dose treatment program. J Clin Oncol. 1998 Aug;16(8):2825-33. [PubMed:9704735 ]
  2. Edwards JC, Szczepanski L, Szechinski J, Filipowicz-Sosnowska A, Emery P, Close DR, Stevens RM, Shaw T: Efficacy of B-cell-targeted therapy with rituximab in patients with rheumatoid arthritis. N Engl J Med. 2004 Jun 17;350(25):2572-81. [PubMed:15201414 ]
  3. Braendstrup P, Bjerrum OW, Nielsen OJ, Jensen BA, Clausen NT, Hansen PB, Andersen I, Schmidt K, Andersen TM, Peterslund NA, Birgens HS, Plesner T, Pedersen BB, Hasselbalch HC: Rituximab chimeric anti-CD20 monoclonal antibody treatment for adult refractory idiopathic thrombocytopenic purpura. Am J Hematol. 2005 Apr;78(4):275-80. [PubMed:15795920 ]
  4. Binder M, Otto F, Mertelsmann R, Veelken H, Trepel M: The epitope recognized by rituximab. Blood. 2006 Sep 15;108(6):1975-8. Epub 2006 May 16. [PubMed:16705086 ]
  5. Burton C, Kaczmarski R, Jan-Mohamed R: Interstitial pneumonitis related to rituximab therapy. N Engl J Med. 2003 Jun 26;348(26):2690-1; discussion 2690-1. [PubMed:12826649 ]
  6. Link [Link]
  7. Link [Link]
External Links
UniProt
P01857
Genbank
J00228
ChEMBL
CHEMBL1201576
Therapeutic Targets Database
DAP000382
PharmGKB
PA451261
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Rituximab
ATC Codes
L01XC02 — Rituximab
AHFS Codes
  • 10:00.00
PDB Entries
FDA label
Download (401 KB)
MSDS
Not Available

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0Active Not RecruitingTreatmentNeuroblastomas1
0Active Not RecruitingTreatmentProstate Cancer1
0CompletedTreatmentContiguous Stage II Adult Diffuse Large Cell Lymphoma / Contiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Contiguous Stage II Grade 1 Follicular Lymphoma / Contiguous Stage II Grade 2 Follicular Lymphoma / Contiguous Stage II Grade 3 Follicular Lymphoma / Contiguous Stage II Mantle Cell Lymphoma / Contiguous Stage II Marginal Zone Lymphoma / Contiguous Stage II Small Lymphocytic Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Noncontiguous Stage II Adult Diffuse Large Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Noncontiguous Stage II Grade 1 Follicular Lymphoma / Noncontiguous Stage II Grade 2 Follicular Lymphoma / Noncontiguous Stage II Grade 3 Follicular Lymphoma / Noncontiguous Stage II Mantle Cell Lymphoma / Noncontiguous Stage II Marginal Zone Lymphoma / Noncontiguous Stage II Small Lymphocytic Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Stage I Adult Diffuse Large Cell Lymphoma / Stage I Adult Diffuse Small Cleaved Cell Lymphoma / Stage I Grade 1 Follicular Lymphoma / Stage I Grade 2 Follicular Lymphoma / Stage I Grade 3 Follicular Lymphoma / Stage I Mantle Cell Lymphoma / Stage I Marginal Zone Lymphoma / Stage I Small Lymphocytic Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Small Cleaved Cell Lymphoma / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Grade 3 Follicular Lymphoma / Stage III Mantle Cell Lymphoma / Stage III Marginal Zone Lymphoma / Stage III Small Lymphocytic Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Small Cleaved Cell Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Grade 3 Follicular Lymphoma / Stage IV Mantle Cell Lymphoma / Stage IV Marginal Zone Lymphoma / Stage IV Small Lymphocytic Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
0CompletedTreatmentGlomerulonephritis membranous1
0CompletedTreatmentMalignant Lymphomas1
0CompletedTreatmentNonneoplastic Condition1
0RecruitingTreatmentHaematological disorders / Oncologic Disorders / Rheumatologic Disorders1
0RecruitingTreatmentMalignant Lymphomas1
0RecruitingTreatmentMalignant Lymphomas / Mantle Cell Lymphoma (MCL)1
0TerminatedTreatmentAcute Kidney Injury (AKI)1
0TerminatedTreatmentLymphoma, B-Cell1
0WithdrawnTreatmentBrain and Central Nervous System Tumors / Malignant Lymphomas / Neurotoxicity1
1Active Not RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL)1
1Active Not RecruitingTreatmentB Chronic Lymphocytic Leukemia / Chronic Lymphocytic Leukaemia (CLL) / Small Lymphocytic Lymphoma (SLL)1
1Active Not RecruitingTreatmentB-Cell Malignancies1
1Active Not RecruitingTreatmentBurkitt's Lymphoma / Follicular Lymphoma (FL) / Lymphoma, Large B-Cell, Diffuse (DLBCL)1
1Active Not RecruitingTreatmentCD20 Positive / Recurrent B-Cell Non-Hodgkin Lymphoma / Refractory B-Cell Non-Hodgkin Lymphoma1
1Active Not RecruitingTreatmentCD20 Positive / Recurrent Diffuse Large B-Cell Lymphoma / Refractory Diffuse Large B-Cell Lymphoma1
1Active Not RecruitingTreatmentCD20 Positive / Stage II Grade 1 Contiguous Follicular Lymphoma / Stage II Grade 1 Non-Contiguous Follicular Lymphoma / Stage II Grade 2 Contiguous Follicular Lymphoma / Stage II Grade 2 Non-Contiguous Follicular Lymphoma / Stage II Grade 3 Contiguous Follicular Lymphoma / Stage II Grade 3 Non-Contiguous Follicular Lymphoma / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Grade 3 Follicular Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Grade 3 Follicular Lymphoma1
1Active Not RecruitingTreatmentCD20-Positive Lymphoid Malignancies / Chronic Lymphocytic Leukaemia (CLL) / Haematological Malignancies / Non-Hodgkin's Lymphoma (NHL)1
1Active Not RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Lymphocytic Leukemia, Chronic1
1Active Not RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Small Lymphocytic Lymphoma (SLL)2
1Active Not RecruitingTreatmentDisorder Related to Transplantation / Leukemias / Lymphoid Malignancies / Malignant Lymphomas / Transplantation, Stem Cell1
1Active Not RecruitingTreatmentExtranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Splenic Marginal Zone Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
1Active Not RecruitingTreatmentExtranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Splenic Marginal Zone Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
1Active Not RecruitingTreatmentFollicular Lymphoma (FL)1
1Active Not RecruitingTreatmentGamma Delta Hepatosplenic T-Cell Lymphoma / NK T-Cell Lymphoma / Subcutaneous Panniculitis-Like T-Cell Lymphoma / T-Cell Peripheral Lymphoma1
1Active Not RecruitingTreatmentImpaired Renal Function / Kidney Failure,Chronic1
1Active Not RecruitingTreatmentLeukemias1
1Active Not RecruitingTreatmentLeukemias / Malignant Lymphomas1
1Active Not RecruitingTreatmentLymphocytic Leukemia, Chronic1
1Active Not RecruitingTreatmentMalignant Lymphomas2
1Active Not RecruitingTreatmentMalignant Lymphomas / Mantle Cell Lymphoma (MCL)1
1Active Not RecruitingTreatmentMultiple Myeloma and Plasma Cell Neoplasm1
1Active Not RecruitingTreatmentNon-Hodgkin's Lymphoma (NHL)1
1Active Not RecruitingTreatmentRecurrent Chronic Lymphocytic Leukemia / Recurrent Small Lymphocytic Lymphoma / Refractory Chronic Lymphocytic Leukemia / Refractory Small Lymphocytic Lymphoma / Stage III Chronic Lymphocytic Leukemia / Stage III Small Lymphocytic Lymphoma / Stage IV Chronic Lymphocytic Leukemia / Stage IV Small Lymphocytic Lymphoma1
1Active Not RecruitingTreatmentRefractory/Relapsed Indolent Non-Hodgkin Lymphoma1
1CompletedPreventionTransplantation, Renal1
1CompletedTreatmentAnaplastic Large Cell Lymphoma / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Marginal Zone Lymphoma / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / Testicular Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
1CompletedTreatmentAutoimmune Diseases1
1CompletedTreatmentB Cell Non-Hodgkin's Lymphoma / Non-Hodgkin's Lymphoma (NHL)1
1CompletedTreatmentB-Cell Chronic Lymphocytic Leukemia / Contiguous Stage II Grade 1 Follicular Lymphoma / Contiguous Stage II Grade 2 Follicular Lymphoma / Contiguous Stage II Mantle Cell Lymphoma / Contiguous Stage II Marginal Zone Lymphoma / Contiguous Stage II Small Lymphocytic Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Noncontiguous Stage II Grade 1 Follicular Lymphoma / Noncontiguous Stage II Grade 2 Follicular Lymphoma / Noncontiguous Stage II Mantle Cell Lymphoma / Noncontiguous Stage II Marginal Zone Lymphoma / Noncontiguous Stage II Small Lymphocytic Lymphoma / Progressive Hairy Cell Leukemia, Initial Treatment / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Refractory Chronic Lymphocytic Leukemia / Refractory Hairy Cell Leukemia / Splenic Marginal Zone Lymphoma / Stage I Chronic Lymphocytic Leukemia / Stage I Grade 1 Follicular Lymphoma / Stage I Grade 2 Follicular Lymphoma / Stage I Mantle Cell Lymphoma / Stage I Marginal Zone Lymphoma / Stage I Small Lymphocytic Lymphoma / Stage II Chronic Lymphocytic Leukemia / Stage III Chronic Lymphocytic Leukemia / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Mantle Cell Lymphoma / Stage III Marginal Zone Lymphoma / Stage III Small Lymphocytic Lymphoma / Stage IV Chronic Lymphocytic Leukemia / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Mantle Cell Lymphoma / Stage IV Marginal Zone Lymphoma / Stage IV Small Lymphocytic Lymphoma / Untreated Hairy Cell Leukemia / Waldenstrom's Macroglobulinemia (WM)1
1CompletedTreatmentB-Cell Malignancies1
1CompletedTreatmentB-cell Adult Acute Lymphoblastic Leukemia / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Noncontiguous Stage II Adult Burkitt Lymphoma / Noncontiguous Stage II Adult Diffuse Large Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Mixed Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Noncontiguous Stage II Adult Immunoblastic Large Cell Lymphoma / Noncontiguous Stage II Adult Lymphoblastic Lymphoma / Noncontiguous Stage II Grade 1 Follicular Lymphoma / Noncontiguous Stage II Grade 2 Follicular Lymphoma / Noncontiguous Stage II Grade 3 Follicular Lymphoma / Noncontiguous Stage II Mantle Cell Lymphoma / Noncontiguous Stage II Marginal Zone Lymphoma / Noncontiguous Stage II Small Lymphocytic Lymphoma / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Splenic Marginal Zone Lymphoma / Stage III Adult Burkitt Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Mixed Cell Lymphoma / Stage III Adult Diffuse Small Cleaved Cell Lymphoma / Stage III Adult Immunoblastic Large Cell Lymphoma / Stage III Adult Lymphoblastic Lymphoma / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Grade 3 Follicular Lymphoma / Stage III Mantle Cell Lymphoma / Stage III Marginal Zone Lymphoma / Stage III Small Lymphocytic Lymphoma / Stage IV Adult Burkitt Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Mixed Cell Lymphoma / Stage IV Adult Diffuse Small Cleaved Cell Lymphoma / Stage IV Adult Immunoblastic Large Cell Lymphoma / Stage IV Adult Lymphoblastic Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Grade 3 Follicular Lymphoma / Stage IV Mantle Cell Lymphoma / Stage IV Marginal Zone Lymphoma / Stage IV Small Lymphocytic Lymphoma1
1CompletedTreatmentB-cell Small Lymphocytic Lymphoma Recurrent1
1CompletedTreatmentBlood And Marrow Transplantation / Leukemias / Malignant Lymphomas / Transplantation Infection / Transplantation, Bone Marrow1
1CompletedTreatmentBrain and Central Nervous System Tumors / Malignant Lymphomas1
1CompletedTreatmentCentral Nervous System Lymphoma / Intraocular Lymphoma1
1CompletedTreatmentChronic Focal Encephalitis / Rasmussen's Encephalitis1
1CompletedTreatmentChronic Lymphocytic Leukaemia (CLL)3
1CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Indolent Non-Hodgkin's Lymphomas / Mantle Cell Lymphoma (MCL)1
1CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Malignant Lymphomas / Non-Hodgkin's Lymphoma (NHL) / T-Cell Lymphomas1
1CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Non-Hodgkin's Lymphoma (NHL)1
1CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Non-Hodgkin's Lymphoma (NHL) / Non-Hodgkin's Lymphoma, Chronic Lymphocytic Leukemia1
1CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Small Lymphocytic Lymphoma (SLL)1
1CompletedTreatmentChronic Myeloproliferative Disorders / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms1
1CompletedTreatmentExtranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Hematopoietic/Lymphoid Cancer / Nodal marginal zone B-cell lymphomas / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Refractory Chronic Lymphocytic Leukemia / Splenic Marginal Zone Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
1CompletedTreatmentFollicular Lymphoma (FL)2
1CompletedTreatmentFollicular Lymphoma (FL) / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Mantle Cell Lymphoma (MCL) / Non-Hodgkin's Lymphoma (NHL)1
1CompletedTreatmentGranulomatosis With Polyangiitis1
1CompletedTreatmentKidney Failure,Chronic / Renal Failure / Transplantation, Bone Marrow / Transplantation, Kidney1
1CompletedTreatmentKidney Insufficiency1
1CompletedTreatmentLeukemia Lymphocytic Chronic B-Cell1
1CompletedTreatmentLeukemia, Lymphocytic, Chronic, B-Cell1
1CompletedTreatmentLeukemias / Malignant Lymphomas / Plasma Cell Myeloma1
1CompletedTreatmentLeukemias / Myelodysplastic Syndrome1
1CompletedTreatmentLymphoma, B-Cell1
1CompletedTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)2
1CompletedTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL) / Non-Hodgkin's Lymphoma (NHL)1
1CompletedTreatmentLymphoma, Low-Grade / Lymphoma, Mixed-Cell, Follicular / Lymphoma, Small Cleaved-Cell, Follicular / Small Lymphocytic Lymphoma (SLL)1
1CompletedTreatmentMacular Degeneration1
1CompletedTreatmentMalignancies, Hematologic1
1CompletedTreatmentMalignant Lymphomas10
1CompletedTreatmentMembranoproliferative Glomerulonephritis1
1CompletedTreatmentMultiple Sclerosis, Primary Progressive / Secondary Progressive Multiple Sclerosis (SPMS)1
1CompletedTreatmentNeuromyelitis Optica1
1CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)3
1CompletedTreatmentNon-Hodgkin's Lymphoma, Chronic Lymphocytic Leukemia1
1CompletedTreatmentPsoriatic Arthritis1
1CompletedTreatmentRefractory Chronic Lymphocytic Leukemia1
1CompletedTreatmentRheumatoid Arthritis1
1CompletedTreatmentSjögren's Syndrome1
1Not Yet RecruitingTreatmentCD20 Positive / HIV Positivity / Lymphoma, AIDS Related / Stage II Diffuse Large B-Cell Lymphoma / Stage III Diffuse Large B-Cell Lymphoma / Stage IV Diffuse Large B-Cell Lymphoma1
1Not Yet RecruitingTreatmentFollicular Lymphoma (FL)1
1RecruitingTreatmentAnticytokine Autoantibody-Associated Diseases / Chronic Mucocutaneous Candidiasis (CMC) / Disseminated Non-Tuberculous Mycobacteria / Pulmonary Alveolar Proteinosis (PAP)1
1RecruitingTreatmentAutoimmune Pancreatitis / IgG4-related Disease / IgG4-related Sclerosing Cholangitis / Immunoglobulin G Subclass 4 Related Disease / Retroperitoneal Fibrosis1
1RecruitingTreatmentCarcinoma, Squamous Cell of Head and Neck / Follicular Lymphoma (FL) / Lung Cancer Non-Small Cell Cancer (NSCLC) / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Malignant Melanoma / Non-Hodgkin's Lymphoma (NHL) / Renal Cell Adenocarcinoma1
1RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL)1
1RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias1
1RecruitingTreatmentContiguous Stage II Adult Lymphoblastic Lymphoma / Noncontiguous Stage II Adult Lymphoblastic Lymphoma / Stage I Adult Lymphoblastic Lymphoma / Stage III Adult Lymphoblastic Lymphoma / Stage IV Adult Lymphoblastic Lymphoma / Untreated Adult Acute Lymphoblastic Leukemia1
1RecruitingTreatmentDiffuse Large B-Cell Lymphoma, Lymphoma Follicular / Diffuse Large B-Cell Lymphoma, Lymphoma, Follicular1
1RecruitingTreatmentFollicular Lymphoma (FL)1
1RecruitingTreatmentFollicular Lymphoma (FL) / Lymphoma, B-Cell, Marginal Zone / Lymphoma, Mantle-Cell / Lymphoma, Small-Cell / Non-Hodgkin's Lymphoma (NHL) / Waldenstrom's Macroglobulinemia (WM)1
1RecruitingTreatmentFollicular Lymphoma (FL) / Lymphoma, Large B-Cell, Diffuse (DLBCL)1
1RecruitingTreatmentHigh Grade B-cell Lymphoma / Lymphoma, Large B-Cell, Diffuse (DLBCL)1
1RecruitingTreatmentIntraocular Lymphoma / Recurrent/Refractory CNS1
1RecruitingTreatmentLeukemias2
1RecruitingTreatmentLymphoma, B-Cell3
1RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)3
1RecruitingTreatmentMalignant Lymphomas3
1RecruitingTreatmentMalignant Lymphomas / Non-Hodgkin's Lymphoma (NHL)1
1RecruitingTreatmentMantle Cell Lymphoma (MCL)2
1RecruitingTreatmentNeoplasms, Hematologic1
1RecruitingTreatmentNon-Hodgkin's Lymphoma (NHL)3
1RecruitingTreatmentPompe's Disease1
1RecruitingTreatmentRecurrent B-Cell Non-Hodgkin Lymphoma / Recurrent Mantle Cell Lymphoma / Refractory B-Cell Non-Hodgkin Lymphoma / Refractory Mantle Cell Lymphoma1
1RecruitingTreatmentRefractory Diffuse Large B-Cell Lymphoma / Relapsed Diffuse Large B-Cell Lymphoma1
1RecruitingTreatmentRheumatoid Arthritis3
1RecruitingTreatmentTransplants and Implants1
1SuspendedTreatmentPrimary Central Nervious System Lymphoma1
1TerminatedTreatmentAIDS-related Peripheral/Systemic Lymphoma / AIDS-related Primary CNS Lymphoma / Post-Transplant Lymphoproliferative Disorder / Recurrent Childhood Large Cell Lymphoma / Recurrent Childhood Lymphoblastic Lymphoma / Recurrent Childhood Small Noncleaved Cell Lymphoma / Recurrent/Refractory Childhood Hodgkin Lymphoma1
1TerminatedTreatmentAdult Grade III Lymphomatoid Granulomatosis / Adult Non-Hodgkin's Lymphoma / Contiguous Stage II Adult Burkitt Lymphoma / Contiguous Stage II Adult Diffuse Large Cell Lymphoma / Contiguous Stage II Adult Diffuse Mixed Cell Lymphoma / Contiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Contiguous Stage II Adult Immunoblastic Large Cell Lymphoma / Contiguous Stage II Adult Lymphoblastic Lymphoma / Contiguous Stage II Grade 1 Follicular Lymphoma / Contiguous Stage II Grade 2 Follicular Lymphoma / Contiguous Stage II Grade 3 Follicular Lymphoma / Contiguous Stage II Mantle Cell Lymphoma / Contiguous Stage II Marginal Zone Lymphoma / Contiguous Stage II Small Lymphocytic Lymphoma / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Noncontiguous Stage II Adult Burkitt Lymphoma / Noncontiguous Stage II Adult Diffuse Large Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Mixed Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Noncontiguous Stage II Adult Immunoblastic Large Cell Lymphoma / Noncontiguous Stage II Adult Lymphoblastic Lymphoma / Noncontiguous Stage II Grade 1 Follicular Lymphoma / Noncontiguous Stage II Grade 2 Follicular Lymphoma / Noncontiguous Stage II Grade 3 Follicular Lymphoma / Noncontiguous Stage II Mantle Cell Lymphoma / Noncontiguous Stage II Marginal Zone Lymphoma / Noncontiguous Stage II Small Lymphocytic Lymphoma / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Splenic Marginal Zone Lymphoma / Stage I Adult Burkitt Lymphoma / Stage I Adult Diffuse Large Cell Lymphoma / Stage I Adult Diffuse Mixed Cell Lymphoma / Stage I Adult Diffuse Small Cleaved Cell Lymphoma / Stage I Adult Immunoblastic Large Cell Lymphoma / Stage I Adult Lymphoblastic Lymphoma / Stage I Grade 1 Follicular Lymphoma / Stage I Grade 2 Follicular Lymphoma / Stage I Grade 3 Follicular Lymphoma / Stage I Mantle Cell Lymphoma / Stage I Marginal Zone Lymphoma / Stage I Small Lymphocytic Lymphoma / Stage III Adult Burkitt Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Mixed Cell Lymphoma / Stage III Adult Diffuse Small Cleaved Cell Lymphoma / Stage III Adult Immunoblastic Large Cell Lymphoma / Stage III Adult Lymphoblastic Lymphoma / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Grade 3 Follicular Lymphoma / Stage III Mantle Cell Lymphoma / Stage III Marginal Zone Lymphoma / Stage III Small Lymphocytic Lymphoma / Stage IV Adult Burkitt Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Mixed Cell Lymphoma / Stage IV Adult Diffuse Small Cleaved Cell Lymphoma / Stage IV Adult Immunoblastic Large Cell Lymphoma / Stage IV Adult Lymphoblastic Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Grade 3 Follicular Lymphoma / Stage IV Mantle Cell Lymphoma / Stage IV Marginal Zone Lymphoma / Stage IV Small Lymphocytic Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
1TerminatedTreatmentB-cell Adult Acute Lymphoblastic Leukemia / B-Cell Chronic Lymphocytic Leukemia / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Small Lymphocytic Lymphoma / Refractory Chronic Lymphocytic Leukemia / Refractory Hairy Cell Leukemia / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / Testicular Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
1TerminatedTreatmentB-Cell Chronic Lymphocytic Leukemia / Leukemia, Prolymphocytic / Leukemias / Refractory Chronic Lymphocytic Leukemia / Stage I Chronic Lymphocytic Leukemia / Stage II Chronic Lymphocytic Leukemia / Stage III Chronic Lymphocytic Leukemia / Stage IV Chronic Lymphocytic Leukemia1
1TerminatedTreatmentB-Cell Chronic Lymphocytic Leukemia / Leukemia, Prolymphocytic / Refractory Chronic Lymphocytic Leukemia1
1TerminatedTreatmentChronic Lymphocytic Leukaemia (CLL) / Follicular Lymphoma (FL) / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Mantle Cell Lymphoma (MCL) / Small Lymphocytic Lymphoma (SLL)1
1TerminatedTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemia, Lymphocytic, Chronic, B-Cell / Small Lymphocytic Lymphoma (SLL)1
1TerminatedTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemia, Prolymphocytic / Recurrent Small Lymphocytic Lymphoma / Refractory Chronic Lymphocytic Leukemia / Stage I Chronic Lymphocytic Leukemia / Stage I Small Lymphocytic Lymphoma / Stage II Chronic Lymphocytic Leukemia / Stage II Small Lymphocytic Lymphoma / Stage III Chronic Lymphocytic Leukemia / Stage III Small Lymphocytic Lymphoma / Stage IV Chronic Lymphocytic Leukemia / Stage IV Small Lymphocytic Lymphoma1
1TerminatedTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemia, Small Lymphocytic1
1TerminatedTreatmentChronic Lymphocytic Leukaemia (CLL) / Small Lymphocytic Lymphoma (SLL)1
1TerminatedTreatmentLeukemias / Lymphoproliferative Disorders / Malignant Lymphomas1
1TerminatedTreatmentLeukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm1
1TerminatedTreatmentLeukemias / Malignant Lymphomas / Plasma Cell Myeloma1
1TerminatedTreatmentLymphoma, B-Cell / Non-Hodgkin's Lymphoma (NHL)1
1TerminatedTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)1
1TerminatedTreatmentMalignant Lymphomas2
1TerminatedTreatmentMetastatic Melanoma1
1TerminatedTreatmentRheumatoid Arthritis1
1TerminatedTreatmentWaldenstrom's Macroglobulinemia (WM)1
1Unknown StatusNot AvailableRheumatoid Arthritis1
1Unknown StatusTreatmentMalignant Lymphomas1
1WithdrawnTreatmentLeukemias / Malignant Lymphomas / Pediatric Disorders / Transplantation, Stem Cell1
1WithdrawnTreatmentMalignant Lymphomas1
1, 2Active Not RecruitingTreatmentAIDS-Related Diffuse Large Cell Lymphoma / AIDS-Related Plasmablastic Lymphoma / AIDS-Related Primary Effusion Lymphoma / CD20 Positive / Grade 3b Follicular Lymphoma / Human Immunodeficiency Virus (HIV) Infections / Plasmablastic Lymphoma / Primary Effusion Lymphomas / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Stage I Adult Diffuse Large Cell Lymphoma / Stage I Diffuse Large B-Cell Lymphoma / Stage I Grade 3 Follicular Lymphoma / Stage II Contiguous Adult Diffuse Large Cell Lymphoma / Stage II Diffuse Large B-Cell Lymphoma / Stage II Grade 3 Contiguous Follicular Lymphoma / Stage II Grade 3 Non-Contiguous Follicular Lymphoma / Stage II Non-Contiguous Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage III Diffuse Large B-Cell Lymphoma / Stage III Grade 3 Follicular Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma / Stage IV Diffuse Large B-Cell Lymphoma / Stage IV Grade 3 Follicular Lymphoma1
1, 2Active Not RecruitingTreatmentAdvanced Cancers / Malignant Lymphomas1
1, 2Active Not RecruitingTreatmentB-Cell Chronic Lymphocytic Leukemia / Refractory Chronic Lymphocytic Leukemia / Stage 0 Chronic Lymphocytic Leukemia / Stage I Chronic Lymphocytic Leukemia / Stage II Chronic Lymphocytic Leukemia1
1, 2Active Not RecruitingTreatmentB-Cell Malignancies1
1, 2Active Not RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL)1
1, 2Active Not RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Stage I Chronic Lymphocytic Leukemia / Stage I Small Lymphocytic Lymphoma / Stage II Chronic Lymphocytic Leukemia / Stage II Small Lymphocytic Lymphoma / Stage III Chronic Lymphocytic Leukemia / Stage III Small Lymphocytic Lymphoma / Stage IV Chronic Lymphocytic Leukemia / Stage IV Small Lymphocytic Lymphoma1
1, 2Active Not RecruitingTreatmentCognitive Side Effects of Cancer Therapy / Neurotoxicity Syndrome / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Therapy-Related Toxicity / Tiredness / Waldenstrom's Macroglobulinemia (WM)1
1, 2Active Not RecruitingTreatmentDiffuse Large B Cell Lymphoma Refractory / Diffuse Large B Cell Lymphoma Relapsed1
1, 2Active Not RecruitingTreatmentDiffuse Large B-Cell Lymphoma, Lymphoma, Follicular / Follicular Lymphoma, Diffuse Large B-Cell Lymphoma / Lymphoma, Follicular, Diffuse Large B-Cell Lymphoma1
1, 2Active Not RecruitingTreatmentDiffuse Large B-Cell Lymphoma, Lymphoma, Non Hodgkin, Lymphoma, Follicular / Malignant Lymphomas1
1, 2Active Not RecruitingTreatmentEnd Stage Renal Disease (ESRD)2
1, 2Active Not RecruitingTreatmentLeukaemia, Acute / Lymphoma, Hodgkins / Multiple Myeloma (MM) / Myelodysplastic Syndrome / Non-Hodgkin's Disease1
1, 2Active Not RecruitingTreatmentLeukemias / Malignant Lymphomas1
1, 2Active Not RecruitingTreatmentLymphoma, B-Cell, Non-Hodgkin's Lymphoma / Non Hodgkin Lymphoma (NHL)1
1, 2Active Not RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)1
1, 2Active Not RecruitingTreatmentMalignant Lymphomas4
1, 2Active Not RecruitingTreatmentMantle Cell Lymphoma (MCL)2
1, 2Active Not RecruitingTreatmentNon-Hodgkin's Lymphoma (NHL)2
1, 2Active Not RecruitingTreatmentRecurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma1
1, 2Active Not RecruitingTreatmentRecurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Hodgkin's Lymphoma1
1, 2Active Not RecruitingTreatmentStage II Contiguous Adult Diffuse Large Cell Lymphoma / Stage II Non-Contiguous Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma1
1, 2Active Not RecruitingTreatmentWaldenstrom's Macroglobulinemia (WM)1
1, 2CompletedPreventionHaematological Malignancies1
1, 2CompletedTreatmentAdult B Acute Lymphoblastic Leukemia / Adult Nasal Type Extranodal NK/T-Cell Lymphoma / Adult Solid Neoplasm / Anaplastic Large Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / Chronic Lymphocytic Leukaemia (CLL) / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone Lymphoma of Mucosa-Associated Lymphoid Tissue / Hepatosplenic T-Cell Lymphoma / Intraocular Lymphoma / Lymphomatous Involvement of Non-Cutaneous Extranodal Site / Mature T-Cell and NK-Cell Non-Hodgkin Lymphoma / Nodal Marginal Zone Lymphoma / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mycosis Fungoides and Sezary Syndrome / Recurrent Small Lymphocytic Lymphoma / Refractory Chronic Lymphocytic Leukemia / Refractory Hairy Cell Leukemia / Refractory Plasma Cell Myeloma / Small Intestinal Lymphoma / Splenic Marginal Zone Lymphoma / Testicular Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
1, 2CompletedTreatmentAdult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / Contiguous Stage II Mantle Cell Lymphoma / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Noncontiguous Stage II Mantle Cell Lymphoma / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Small Lymphocytic Lymphoma / Splenic Marginal Zone Lymphoma / Stage I Cutaneous T-cell Non-Hodgkin Lymphoma / Stage I Mantle Cell Lymphoma / Stage I Mycosis Fungoides/Sezary Syndrome / Stage II Cutaneous T-cell Non-Hodgkin Lymphoma / Stage II Mycosis Fungoides/Sezary Syndrome / Stage III Cutaneous T-Cell Non-Hodgkin Lymphoma / Stage III Mantle Cell Lymphoma / Stage III Mycosis Fungoides/Sezary Syndrome / Stage IV Cutaneous T-Cell Non-Hodgkin Lymphoma / Stage IV Mantle Cell Lymphoma / Stage IV Mycosis Fungoides/Sezary Syndrome / Waldenstrom's Macroglobulinemia (WM)1
1, 2CompletedTreatmentAdult Non-Hodgkin's Lymphoma / Extranodal Marginal Zone Lymphoma of Mucosa-Associated Lymphoid Tissue / Nodal Marginal Zone Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Splenic Marginal Zone Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
1, 2CompletedTreatmentAdvanced Solid Tumors / Aggressive B-cell Lymphomas1
1, 2CompletedTreatmentAtaxia / Myoclonus / Opsoclonus / Opsoclonus-myoclonus Syndrome1
1, 2CompletedTreatmentAutoimmune Pancreatitis / Pseudotumor / Retroperitoneal Fibrosis / Sialoadenitis1
1, 2CompletedTreatmentB-cell Non Hodgkin's Lymphoma1
1, 2CompletedTreatmentBrain and Central Nervous System Tumors / Malignant Lymphomas1
1, 2CompletedTreatmentBullous Pemphigoid (BP)1
1, 2CompletedTreatmentCD20+ Follicular Lymphoma1
1, 2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL)2
1, 2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias / Malignant Lymphomas1
1, 2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Recurrent Small Lymphocytic Lymphoma / Refractory Chronic Lymphocytic Leukemia1
1, 2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Small Lymphocytic Lymphoma (SLL)1
1, 2CompletedTreatmentChronic Rejection / Kidney Insufficiency1
1, 2CompletedTreatmentFollicular Lymphoma (FL) / Lymphoma, B-Cell1
1, 2CompletedTreatmentFollicular Lymphoma (FL) / Mantle Cell Lymphoma (MCL)1
1, 2CompletedTreatmentGraft Versus Host Disease (GVHD)1
1, 2CompletedTreatmentGraves' Dysthyroid Ophthalmopathy / Thyroid Related Orbitopathy1
1, 2CompletedTreatmentGraves´ Disease / Thyroid Associated Ophthalmopathy1
1, 2CompletedTreatmentHodgkins Disease (HD) / Malignant Lymphomas1
1, 2CompletedTreatmentIdiopathic Thrombocytopenic Purpura (ITP) / Immune Thrombocytopenic Purpura ( ITP )1
1, 2CompletedTreatmentLeukemia, Lymphocytic, Chronic, B-Cell1
1, 2CompletedTreatmentLeukemias2
1, 2CompletedTreatmentLeukemias / Malignant Lymphomas2
1, 2CompletedTreatmentLeukemias / Richter's Transformation1
1, 2CompletedTreatmentLupus Erythematosus, Systemic1
1, 2CompletedTreatmentLymphoma, B-Cell1
1, 2CompletedTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)2
1, 2CompletedTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL) / Mantle Cell Lymphoma (MCL) / Non-Hodgkin's Lymphoma (NHL)1
1, 2CompletedTreatmentMalignant Lymphomas8
1, 2CompletedTreatmentMalignant Lymphomas / Non Hodgkin Lymphoma (NHL)1
1, 2CompletedTreatmentMantle Cell Lymphoma (MCL)1
1, 2CompletedTreatmentOcular Cicatricial Pemphigoid1
1, 2CompletedTreatmentOrbital Disease / Scleritis1
1, 2CompletedTreatmentPost-Transplant Lymphoproliferative Disorder / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Stage III Adult Burkitt Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage IV Adult Burkitt Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
1, 2CompletedTreatmentPrimary Biliary Cirrhosis (PBC)1
1, 2CompletedTreatmentRecurrent Adult Diffuse Large Cell Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma1
1, 2CompletedTreatmentRefractory Myasthenia Gravis1
1, 2CompletedTreatmentRheumatoid Arthritis3
1, 2CompletedTreatmentSjögren's Syndrome1
1, 2CompletedTreatmentTransplant, Kidney1
1, 2Not Yet RecruitingTreatmentAdult Burkitt Lymphoma / B-Cell Lymphoma, Unclassifiable, With Features Intermediate Between Diffuse Large B-Cell Lymphoma and Burkitt Lymphoma / Lymphoma, Large B-Cell, Diffuse (DLBCL) / MYC Gene Mutation / Plasmablastic Lymphoma1
1, 2Not Yet RecruitingTreatmentDiffuse B-Cell Lymphoma1
1, 2Not Yet RecruitingTreatmentLymphoma, B Cell / Malignant Lymphomas1
1, 2Not Yet RecruitingTreatmentMalignant Lymphomas / Malignant Neoplasms Stated as Primary Lymphoid Haematopoietic1
1, 2Not Yet RecruitingTreatmentNon Hodgkin Lymphoma (NHL)1
1, 2RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Leukemias1
1, 2RecruitingTreatmentAdult Grade III Lymphomatoid Granulomatosis / Adult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / Contiguous Stage II Adult Burkitt Lymphoma / Contiguous Stage II Adult Diffuse Large Cell Lymphoma / Contiguous Stage II Adult Diffuse Mixed Cell Lymphoma / Contiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Contiguous Stage II Adult Immunoblastic Large Cell Lymphoma / Contiguous Stage II Adult Lymphoblastic Lymphoma / Contiguous Stage II Grade 1 Follicular Lymphoma / Contiguous Stage II Grade 2 Follicular Lymphoma / Contiguous Stage II Grade 3 Follicular Lymphoma / Contiguous Stage II Mantle Cell Lymphoma / Contiguous Stage II Marginal Zone Lymphoma / Contiguous Stage II Small Lymphocytic Lymphoma / Cutaneous B-Cell Non-Hodgkin Lymphoma / Epstein-Barr Virus Infections / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Hepatosplenic T-Cell Lymphoma / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Noncontiguous Stage II Adult Burkitt Lymphoma / Noncontiguous Stage II Adult Diffuse Large Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Mixed Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Noncontiguous Stage II Adult Immunoblastic Large Cell Lymphoma / Noncontiguous Stage II Adult Lymphoblastic Lymphoma / Noncontiguous Stage II Grade 1 Follicular Lymphoma / Noncontiguous Stage II Grade 2 Follicular Lymphoma / Noncontiguous Stage II Grade 3 Follicular Lymphoma / Noncontiguous Stage II Mantle Cell Lymphoma / Noncontiguous Stage II Marginal Zone Lymphoma / Noncontiguous Stage II Small Lymphocytic Lymphoma / Noncutaneous Extranodal Lymphoma / Peripheral T-Cell Lymphoma (PTCL) / Post-Transplant Lymphoproliferative Disorder / Progressive Hairy Cell Leukemia, Initial Treatment / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Small Lymphocytic Lymphoma / Refractory Hairy Cell Leukemia / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / Stage I Adult Burkitt Lymphoma / Stage I Adult Diffuse Large Cell Lymphoma / Stage I Adult Diffuse Mixed Cell Lymphoma / Stage I Adult Diffuse Small Cleaved Cell Lymphoma / Stage I Adult Hodgkin Lymphoma / Stage I Adult Immunoblastic Large Cell Lymphoma / Stage I Adult Lymphoblastic Lymphoma / Stage I Adult T-Cell Leukemia/Lymphoma / Stage I Cutaneous T-cell Non-Hodgkin Lymphoma / Stage I Grade 1 Follicular Lymphoma / Stage I Grade 2 Follicular Lymphoma / Stage I Grade 3 Follicular Lymphoma / Stage I Mantle Cell Lymphoma / Stage I Marginal Zone Lymphoma / Stage I Small Lymphocytic Lymphoma / Stage IA Mycosis Fungoides/Sezary Syndrome / Stage IB Mycosis Fungoides/Sezary Syndrome / Stage II Adult Hodgkin Lymphoma / Stage II Adult T-Cell Leukemia/Lymphoma / Stage II Cutaneous T-cell Non-Hodgkin Lymphoma / Stage IIA Mycosis Fungoides/Sezary Syndrome / Stage IIB Mycosis Fungoides/Sezary Syndrome / Stage III Adult Burkitt Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Mixed Cell Lymphoma / Stage III Adult Diffuse Small Cleaved Cell Lymphoma / Stage III Adult Hodgkin Lymphoma / Stage III Adult Immunoblastic Large Cell Lymphoma / Stage III Adult Lymphoblastic Lymphoma / Stage III Adult T-Cell Leukemia/Lymphoma / Stage III Cutaneous T-Cell Non-Hodgkin Lymphoma / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Grade 3 Follicular Lymphoma / Stage III Mantle Cell Lymphoma / Stage III Marginal Zone Lymphoma / Stage III Small Lymphocytic Lymphoma / Stage IIIA Mycosis Fungoides/Sezary Syndrome / Stage IIIB Mycosis Fungoides/Sezary Syndrome / Stage IV Adult Burkitt Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Mixed Cell Lymphoma / Stage IV Adult Diffuse Small Cleaved Cell Lymphoma / Stage IV Adult Hodgkin Lymphoma / Stage IV Adult Immunoblastic Large Cell Lymphoma / Stage IV Adult Lymphoblastic Lymphoma / Stage IV Adult T-Cell Leukemia/Lymphoma / Stage IV Cutaneous T-Cell Non-Hodgkin Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Grade 3 Follicular Lymphoma / Stage IV Mantle Cell Lymphoma / Stage IV Marginal Zone Lymphoma / Stage IV Small Lymphocytic Lymphoma / Stage IVA Mycosis Fungoides/Sezary Syndrome / Stage IVB Mycosis Fungoides/Sezary Syndrome / T-Cell Large Granular Lymphocyte Leukemia / Testicular Lymphoma / Untreated Hairy Cell Leukemia / Waldenstrom's Macroglobulinemia (WM)1
1, 2RecruitingTreatmentAdult Grade III Lymphomatoid Granulomatosis / B-Cell Chronic Lymphocytic Leukemia / Contiguous Stage II Adult Diffuse Large Cell Lymphoma / Contiguous Stage II Adult Diffuse Mixed Cell Lymphoma / Contiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Contiguous Stage II Adult Immunoblastic Large Cell Lymphoma / Contiguous Stage II Grade 1 Follicular Lymphoma / Contiguous Stage II Grade 2 Follicular Lymphoma / Contiguous Stage II Grade 3 Follicular Lymphoma / Contiguous Stage II Mantle Cell Lymphoma / Contiguous Stage II Marginal Zone Lymphoma / Contiguous Stage II Small Lymphocytic Lymphoma / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Noncontiguous Stage II Adult Diffuse Large Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Mixed Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Noncontiguous Stage II Adult Immunoblastic Large Cell Lymphoma / Noncontiguous Stage II Grade 1 Follicular Lymphoma / Noncontiguous Stage II Grade 2 Follicular Lymphoma / Noncontiguous Stage II Grade 3 Follicular Lymphoma / Noncontiguous Stage II Mantle Cell Lymphoma / Noncontiguous Stage II Marginal Zone Lymphoma / Noncontiguous Stage II Small Lymphocytic Lymphoma / Progressive Hairy Cell Leukemia, Initial Treatment / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / Stage 0 Chronic Lymphocytic Leukemia / Stage I Adult Diffuse Large Cell Lymphoma / Stage I Adult Diffuse Mixed Cell Lymphoma / Stage I Adult Diffuse Small Cleaved Cell Lymphoma / Stage I Adult Hodgkin Lymphoma / Stage I Adult Immunoblastic Large Cell Lymphoma / Stage I Chronic Lymphocytic Leukemia / Stage I Grade 1 Follicular Lymphoma / Stage I Grade 2 Follicular Lymphoma / Stage I Grade 3 Follicular Lymphoma / Stage I Mantle Cell Lymphoma / Stage I Marginal Zone Lymphoma / Stage I Small Lymphocytic Lymphoma / Stage II Adult Hodgkin Lymphoma / Stage II Chronic Lymphocytic Leukemia / Stage II Small Lymphocytic Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Mixed Cell Lymphoma / Stage III Adult Diffuse Small Cleaved Cell Lymphoma / Stage III Adult Hodgkin Lymphoma / Stage III Adult Immunoblastic Large Cell Lymphoma / Stage III Chronic Lymphocytic Leukemia / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Grade 3 Follicular Lymphoma / Stage III Mantle Cell Lymphoma / Stage III Marginal Zone Lymphoma / Stage III Small Lymphocytic Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Mixed Cell Lymphoma / Stage IV Adult Diffuse Small Cleaved Cell Lymphoma / Stage IV Adult Hodgkin Lymphoma / Stage IV Adult Immunoblastic Large Cell Lymphoma / Stage IV Chronic Lymphocytic Leukemia / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Grade 3 Follicular Lymphoma / Stage IV Mantle Cell Lymphoma / Stage IV Marginal Zone Lymphoma / Stage IV Small Lymphocytic Lymphoma / Testicular Lymphoma / Untreated Hairy Cell Leukemia / Waldenstrom's Macroglobulinemia (WM)1
1, 2RecruitingTreatmentB-Cell Chronic Lymphocytic Leukemia / Non-Hodgkin's Lymphoma (NHL)1
1, 2RecruitingTreatmentB-cell lymphoma recurrent1
1, 2RecruitingTreatmentCD20 Positive / Contiguous Stage II Adult Diffuse Large Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Diffuse Large B-Cell Lymphoma / Refractory Diffuse Large B-Cell Lymphoma / Stage I Adult Diffuse Large Cell Lymphoma / Stage I Diffuse Large B-Cell Lymphoma / Stage II Diffuse Large B-Cell Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage III Diffuse Large B-Cell Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma / Stage IV Diffuse Large B-Cell Lymphoma1
1, 2RecruitingTreatmentCD20 Positive / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Recurrent Diffuse Large B-Cell Lymphoma / Recurrent Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Refractory Diffuse Large B-Cell Lymphoma / Refractory Mediastinal (Thymic) Large B-Cell Cell Lymphoma / Transformed Recurrent Non-Hodgkin Lymphoma1
1, 2RecruitingTreatmentCentral Nervous System Lymphoma1
1, 2RecruitingTreatmentContiguous Stage II Adult Diffuse Large Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Large Cell Lymphoma / Stage I Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma1
1, 2RecruitingTreatmentDiffuse Large B Cell Non-Hodgkin Lymphoma1
1, 2RecruitingTreatmentFollicular Lymphoma (FL) / Lymphoma, Large B-Cell, Diffuse (DLBCL)1
1, 2RecruitingTreatmentIndolent Lymphoma / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Non-Hodgkin's Lymphoma (NHL)1
1, 2RecruitingTreatmentInflammatory Reaction / Ischaemic Heart Diseases / Myocardial Infarction (MI)1
1, 2RecruitingTreatmentKidney Transplant Rejection1
1, 2RecruitingTreatmentLeukaemia, Acute / Lymphoma, Hodgkins / Multiple Myeloma (MM) / Myelodysplastic Syndrome / Non-Hodgkin's Lymphoma (NHL)1
1, 2RecruitingTreatmentLeukemia, Lymphocytic, Chronic, B-Cell / Malignant Lymphomas1
1, 2RecruitingTreatmentLeukemias / Malignant Lymphomas2
1, 2RecruitingTreatmentLymphoma, B-Cell / Primary Effusion Lymphomas1
1, 2RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)5
1, 2RecruitingTreatmentMalignant Lymphomas4
1, 2RecruitingTreatmentNon-Hodgkin's Lymphoma (NHL)1
1, 2RecruitingTreatmentRefractory Diffuse Large B-Cell Lymphoma / Relapsed Diffuse Large B-Cell Lymphoma1
1, 2RecruitingTreatmentRelapsed or Refractory Follicular Lymphoma, Relapsed or Refractory Diffuse Large B-Cell Lymphoma1
1, 2RecruitingTreatmentRelapsed/Refractory Indolent B Cell Non-Hodgkin Lymphoma1
1, 2RecruitingTreatmentTreatments1
1, 2TerminatedTreatmentAdult Nodular Lymphocyte Predominant Hodgkin Lymphoma / B-Cell Chronic Lymphocytic Leukemia / Contiguous Stage II Adult Burkitt Lymphoma / Contiguous Stage II Adult Diffuse Large Cell Lymphoma / Contiguous Stage II Adult Lymphoblastic Lymphoma / Contiguous Stage II Grade 1 Follicular Lymphoma / Contiguous Stage II Grade 2 Follicular Lymphoma / Contiguous Stage II Mantle Cell Lymphoma / Extranodal Marginal Zone B-cell Lymphoma / Nodal marginal zone B-cell lymphomas / Noncontiguous Stage II Adult Burkitt Lymphoma / Noncontiguous Stage II Adult Diffuse Large Cell Lymphoma / Noncontiguous Stage II Adult Lymphoblastic Lymphoma / Noncontiguous Stage II Grade 1 Follicular Lymphoma / Noncontiguous Stage II Grade 2 Follicular Lymphoma / Noncontiguous Stage II Mantle Cell Lymphoma / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Refractory Chronic Lymphocytic Leukemia / Splenic Marginal Zone Lymphoma / Stage I Adult Burkitt Lymphoma / Stage I Adult Diffuse Large Cell Lymphoma / Stage I Adult Hodgkin Lymphoma / Stage I Adult Lymphoblastic Lymphoma / Stage I Chronic Lymphocytic Leukemia / Stage I Grade 1 Follicular Lymphoma / Stage I Grade 2 Follicular Lymphoma / Stage I Small Lymphocytic Lymphoma / Stage II Adult Hodgkin Lymphoma / Stage II Chronic Lymphocytic Leukemia / Stage II Marginal Zone Lymphoma / Stage II Small Lymphocytic Lymphoma / Stage III Adult Burkitt Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage III Adult Hodgkin Lymphoma / Stage III Adult Lymphoblastic Lymphoma / Stage III Chronic Lymphocytic Leukemia / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Mantle Cell Lymphoma / Stage III Marginal Zone Lymphoma / Stage III Small Lymphocytic Lymphoma / Stage IV Adult Burkitt Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma / Stage IV Adult Hodgkin Lymphoma / Stage IV Adult Lymphoblastic Lymphoma / Stage IV Chronic Lymphocytic Leukemia / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Mantle Cell Lymphoma / Stage IV Marginal Zone Lymphoma / Stage IV Small Lymphocytic Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
1, 2TerminatedTreatmentAggressive Marginal Zone Lymphoma (MZL) / Burkitt Lymphoma (BL) / Follicular Lymphoma Grade III (FL III°) / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Mantle Cell Lymphoma (MCL), Blastoid Variant1
1, 2TerminatedTreatmentDisseminated Sclerosis1
1, 2TerminatedTreatmentExtranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Splenic Marginal Zone Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
1, 2TerminatedTreatmentLeukemias / Lymphoid Malignancies / Metastatic Malignant Neoplasm to the Leptomeninges1
1, 2TerminatedTreatmentLeukemias / Malignant Lymphomas1
1, 2TerminatedTreatmentMalignant Lymphomas1
1, 2TerminatedTreatmentNon-Hodgkin's Lymphoma (NHL)2
1, 2TerminatedTreatmentRheumatoid Arthritis1
1, 2TerminatedTreatmentUrticarias1
1, 2Unknown StatusTreatmentAdult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Peripheral T-Cell Lymphoma (PTCL) / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Small Lymphocytic Lymphoma / Splenic Marginal Zone Lymphoma / Stage III Adult Burkitt Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Mixed Cell Lymphoma / Stage III Adult Diffuse Small Cleaved Cell Lymphoma / Stage III Adult Immunoblastic Large Cell Lymphoma / Stage III Adult Lymphoblastic Lymphoma / Stage III Cutaneous T-Cell Non-Hodgkin Lymphoma / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Grade 3 Follicular Lymphoma / Stage III Mantle Cell Lymphoma / Stage III Marginal Zone Lymphoma / Stage III Mycosis Fungoides/Sezary Syndrome / Stage III Small Lymphocytic Lymphoma / Stage IV Adult Burkitt Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Mixed Cell Lymphoma / Stage IV Adult Diffuse Small Cleaved Cell Lymphoma / Stage IV Adult Immunoblastic Large Cell Lymphoma / Stage IV Adult Lymphoblastic Lymphoma / Stage IV Cutaneous T-Cell Non-Hodgkin Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Grade 3 Follicular Lymphoma / Stage IV Mantle Cell Lymphoma / Stage IV Marginal Zone Lymphoma / Stage IV Mycosis Fungoides/Sezary Syndrome / Stage IV Small Lymphocytic Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
1, 2Unknown StatusTreatmentChronic Lymphocytic Leukaemia (CLL)1
1, 2Unknown StatusTreatmentLeukaemia, Acute / Myelodysplastic Syndrome / Tumors, Solid1
1, 2Unknown StatusTreatmentMalignant Lymphomas1
1, 2Unknown StatusTreatmentNon-Hodgkin's Lymphoma (NHL)4
1, 2Unknown StatusTreatmentRheumatoid Arthritis1
1, 2WithdrawnTreatmentB-cell Adult Acute Lymphoblastic Leukemia / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Refractory Hairy Cell Leukemia / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / Testicular Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
1, 2WithdrawnTreatmentExtranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Splenic Marginal Zone Lymphoma1
1, 2WithdrawnTreatmentLarge Cell Lymphoma Arising in KSHV-associated Multicentric Castleman Disease / Primary Effusion Lymphomas1
1, 2WithdrawnTreatmentLarge-Cell Lymphoma, Diffuse / Lymphoma, Diffuse Large-Cell / Lymphoma, Diffuse Large-Cell B-cell / Lymphoma, Large B-Cell, Diffuse (DLBCL)1
1, 2WithdrawnTreatmentLymphoma, Hodgkins / Malignant Lymphomas / Non-Hodgkin's Lymphoma (NHL)1
1, 2WithdrawnTreatmentMalignant Lymphomas1
1, 2WithdrawnTreatmentThrombotic Thrombocytopenic Purpura (TTP)1
2Active Not RecruitingSupportive CareLymphoma, Large B-Cell, Diffuse (DLBCL)1
2Active Not RecruitingTreatmentAccelerated Phase Chronic Myelogenous Leukemia / Adult Acute Lymphoblastic Leukemia in Remission / Adult Acute Myeloid Leukemia in Remission / Adult Nasal Type Extranodal NK/T-Cell Lymphoma / Blastic Phase Chronic Myelogenous Leukemia / Contiguous Stage II Adult Burkitt Lymphoma / Contiguous Stage II Adult Diffuse Large Cell Lymphoma / Contiguous Stage II Adult Diffuse Mixed Cell Lymphoma / Contiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Contiguous Stage II Adult Immunoblastic Large Cell Lymphoma / Contiguous Stage II Adult Lymphoblastic Lymphoma / Contiguous Stage II Grade 1 Follicular Lymphoma / Contiguous Stage II Grade 2 Follicular Lymphoma / Contiguous Stage II Grade 3 Follicular Lymphoma / Contiguous Stage II Mantle Cell Lymphoma / Contiguous Stage II Marginal Zone Lymphoma / Contiguous Stage II Small Lymphocytic Lymphoma / De Novo Myelodysplastic Syndromes / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Graft Versus Host Disease (GVHD) / Nodal marginal zone B-cell lymphomas / Noncontiguous Stage II Adult Burkitt Lymphoma / Noncontiguous Stage II Adult Diffuse Large Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Mixed Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Noncontiguous Stage II Adult Immunoblastic Large Cell Lymphoma / Noncontiguous Stage II Adult Lymphoblastic Lymphoma / Noncontiguous Stage II Grade 1 Follicular Lymphoma / Noncontiguous Stage II Grade 2 Follicular Lymphoma / Noncontiguous Stage II Grade 3 Follicular Lymphoma / Noncontiguous Stage II Mantle Cell Lymphoma / Noncontiguous Stage II Marginal Zone Lymphoma / Noncontiguous Stage II Small Lymphocytic Lymphoma / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Acute Myeloid Leukemia / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Small Lymphocytic Lymphoma / Refractory Chronic Lymphocytic Leukemia / Relapsing Chronic Myelogenous Leukemia / Secondary Myelodysplastic Syndromes / Splenic Marginal Zone Lymphoma / Stage I Adult Burkitt Lymphoma / Stage I Adult Diffuse Large Cell Lymphoma / Stage I Adult Diffuse Mixed Cell Lymphoma / Stage I Adult Diffuse Small Cleaved Cell Lymphoma / Stage I Adult Immunoblastic Large Cell Lymphoma / Stage I Adult Lymphoblastic Lymphoma / Stage I Adult T-Cell Leukemia/Lymphoma / Stage I Chronic Lymphocytic Leukemia / Stage I Cutaneous T-cell Non-Hodgkin Lymphoma / Stage I Grade 1 Follicular Lymphoma / Stage I Grade 2 Follicular Lymphoma / Stage I Grade 3 Follicular Lymphoma / Stage I Mantle Cell Lymphoma / Stage I Marginal Zone Lymphoma / Stage I Mycosis Fungoides/Sezary Syndrome / Stage I Small Lymphocytic Lymphoma / Stage II Adult T-Cell Leukemia/Lymphoma / Stage II Chronic Lymphocytic Leukemia / Stage II Cutaneous T-cell Non-Hodgkin Lymphoma / Stage II Mycosis Fungoides/Sezary Syndrome / Stage III Adult Burkitt Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Mixed Cell Lymphoma / Stage III Adult Diffuse Small Cleaved Cell Lymphoma / Stage III Adult Immunoblastic Large Cell Lymphoma / Stage III Adult Lymphoblastic Lymphoma / Stage III Adult T-Cell Leukemia/Lymphoma / Stage III Chronic Lymphocytic Leukemia / Stage III Cutaneous T-Cell Non-Hodgkin Lymphoma / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Grade 3 Follicular Lymphoma / Stage III Mantle Cell Lymphoma / Stage III Marginal Zone Lymphoma / Stage III Mycosis Fungoides/Sezary Syndrome / Stage III Small Lymphocytic Lymphoma / Stage IV Adult Burkitt Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Mixed Cell Lymphoma / Stage IV Adult Diffuse Small Cleaved Cell Lymphoma / Stage IV Adult Immunoblastic Large Cell Lymphoma / Stage IV Adult Lymphoblastic Lymphoma / Stage IV Adult T-Cell Leukemia/Lymphoma / Stage IV Chronic Lymphocytic Leukemia / Stage IV Cutaneous T-Cell Non-Hodgkin Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Grade 3 Follicular Lymphoma / Stage IV Mantle Cell Lymphoma / Stage IV Marginal Zone Lymphoma / Stage IV Mycosis Fungoides/Sezary Syndrome / Stage IV Small Lymphocytic Lymphoma / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Adult Acute Myeloid Leukemia / Waldenstrom's Macroglobulinemia (WM)1
2Active Not RecruitingTreatmentAdult Diffuse Large B-Cell Lymphoma / B-cell Non-Hodgkin's Lymphomas / Follicular Lymphoma (FL) / Mantle Cell Lymphoma (MCL) / Non-Hodgkin's Lymphoma (NHL) / T-Cell Non-Hodgkin Lymphoma1
2Active Not RecruitingTreatmentAdult Patients / Chronic Lymphocyte Leukemia1
2Active Not RecruitingTreatmentAdvanced Stage Diffuse Large B-Cell Non-Hodgkin's Lymphoma / Non-Hodgkin's Lymphoma (NHL)1
2Active Not RecruitingTreatmentAnaplastic Large Cell Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Mantle Cell Lymphoma1
2Active Not RecruitingTreatmentB-cell Adult Acute Lymphoblastic Leukemia / B-cell Childhood Acute Lymphoblastic Leukemia / B-Cell Chronic Lymphocytic Leukemia / Childhood Burkitt Lymphoma / Childhood Diffuse Large Cell Lymphoma / Childhood Immunoblastic Large Cell Lymphoma / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Post-Transplant Lymphoproliferative Disorder / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Grade III Lymphomatoid Granulomatosis / Recurrent Childhood Large Cell Lymphoma / Recurrent Childhood Lymphoblastic Lymphoma / Recurrent Childhood Small Noncleaved Cell Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Recurrent/Refractory Childhood Hodgkin Lymphoma / Refractory Chronic Lymphocytic Leukemia / Refractory Hairy Cell Leukemia / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / Testicular Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
2Active Not RecruitingTreatmentB-Cell Chronic Lymphocytic Leukemia / Nodal marginal zone B-cell lymphomas / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Splenic Marginal Zone Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
2Active Not RecruitingTreatmentCD20 Positive / Stage II Diffuse Large B-Cell Lymphoma / Stage III Diffuse Large B-Cell Lymphoma / Stage IV Diffuse Large B-Cell Lymphoma1
2Active Not RecruitingTreatmentCD20+, B-cell Lymphomas / Gray Zone Lymphoma / Hodgkins Disease (HD) / Mantle Cell Lymphoma (MCL) / Non-Mantle Cell Low Grade B Cell Lymphomas (SLL/CLL) / Transformed Lymphoma/DLBCL/PMBCL1
2Active Not RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / CLL1
2Active Not RecruitingTreatmentChemotherapeutic Agent Toxicity / Cognitive/Functional Effects / Malignant Lymphomas / Neurotoxicity / Radiation Toxicity1
2Active Not RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL)4
2Active Not RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemia, Lymphocytic / Leukemias1
2Active Not RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemia, Prolymphocytic / Recurrent Small Lymphocytic Lymphoma / Refractory Chronic Lymphocytic Leukemia / Stage III Chronic Lymphocytic Leukemia / Stage III Small Lymphocytic Lymphoma / Stage IV Chronic Lymphocytic Leukemia / Stage IV Small Lymphocytic Lymphoma / T-Cell Large Granular Lymphocyte Leukemia1
2Active Not RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias2
2Active Not RecruitingTreatmentContiguous Stage II Mantle Cell Lymphoma / Noncontiguous Stage II Mantle Cell Lymphoma / Recurrent Mantle Cell Lymphoma / Stage I Mantle Cell Lymphoma / Stage III Mantle Cell Lymphoma / Stage IV Mantle Cell Lymphoma1
2Active Not RecruitingTreatmentDiffuse Large Cell Lymphoma / Malignant Lymphomas1
2Active Not RecruitingTreatmentEpstein Barr Virus Infections / Post-transplant Lymphoproliferative Disease (PTLD) / Solid Organ Transplant / Stem Cell Transplant (Bone Marrow Transplant)1
2Active Not RecruitingTreatmentEpstein-Barr Virus-Related Post-Transplant Lymphoproliferative Disorder / Monomorphic Post-Transplant Lymphoproliferative Disorder / Polymorphic Post-Transplant Lymphoproliferative Disorder1
2Active Not RecruitingTreatmentExtranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Splenic Marginal Zone Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
2Active Not RecruitingTreatmentExtranodal Marginal Zone Lymphoma of Mucosa-Associated Lymphoid Tissue / Nodal Marginal Zone Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Small Lymphocytic Lymphoma / Refractory Chronic Lymphocytic Leukemia / Splenic Marginal Zone Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
2Active Not RecruitingTreatmentFibrillary Glomerulonephritis1
2Active Not RecruitingTreatmentFollicular B-cell Non-Hodgkin's Lymphoma / Refractory Diffuse Large B Cell Lymphoma1
2Active Not RecruitingTreatmentFollicular Lymphoma (FL)1
2Active Not RecruitingTreatmentFollicular Lymphoma (FL) / Lymphoma of Mucosa-Associated Lymphoid Tissue / Lymphoma, Mantle-Cell / MALT Lymphoma / Marginal Zone B-Cell Lymphoma / Small Lymphocytic Lymphoma (SLL) / Waldenstrom's Macroglobulinemia (WM)1
2Active Not RecruitingTreatmentFollicular Lymphoma (FL) / Lymphoma, B-Cell / Non-Hodgkin's Lymphoma (NHL)1
2Active Not RecruitingTreatmentFollicular Lymphoma (FL) / Relapsed or Refractory Follicular Lymphoma1
2Active Not RecruitingTreatmentFollicular Lymphoma (FL) / Transplantation, Stem Cell1
2Active Not RecruitingTreatmentGlomerulonephritis minimal lesion / Renal Insufficiency,Chronic1
2Active Not RecruitingTreatmentGraft Versus Host Disease (GVHD) / Leukemias / Malignant Lymphomas1
2Active Not RecruitingTreatmentGranulomatosis With Polyangiitis / Wegener's Granulomatosis, Microscopic Polyangiitis1
2Active Not RecruitingTreatmentHemoglobinuria, Paroxysmal Nocturnal (PNH) / Juvenile Myelomonocytic Leukemia (JMML) / Leukemia Acute Myeloid Leukemia (AML) / Leukemia, Acute Lymphocytic (ALL) / Leukemia, Myeloid, Chronic(CML) / Lymphoma, Hodgkins / Lymphoma, Non-Hodgkin (NHL) / Myelodysplastic Syndromes (MDS)1
2Active Not RecruitingTreatmentHigh Risk Non-Hodgkin's Lymphoma1
2Active Not RecruitingTreatmentImmunology / Living Donors / Rituximab / Transplantation, Kidney / Viruses1
2Active Not RecruitingTreatmentIndolent B-cell Lymphoma / Lymphoma, B-Cell1
2Active Not RecruitingTreatmentIndolent Lymphoma / Malignant Lymphomas / Mantle Cell Lymphoma (MCL) / SLL1
2Active Not RecruitingTreatmentLenalidomide / Malignant Lymphomas / Relapses / Rituximab1
2Active Not RecruitingTreatmentLeukemias5
2Active Not RecruitingTreatmentLeukemias / Malignant Lymphomas5
2Active Not RecruitingTreatmentLymphoma, B-Cell1
2Active Not RecruitingTreatmentLymphoma, Hodgkins2
2Active Not RecruitingTreatmentLymphoma, Hodgkins / Lymphoma, Large B-Cell, Diffuse (DLBCL)1
2Active Not RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)8
2Active Not RecruitingTreatmentLymphoma, Mantle-Cell1
2Active Not RecruitingTreatmentLymphoma, Mantle-Cell / Mantle Cell Lymphoma (MCL)1
2Active Not RecruitingTreatmentLymphoproliferative Disorders1
2Active Not RecruitingTreatmentMalignant Lymphomas16
2Active Not RecruitingTreatmentMantle Cell Lymphoma (MCL)4
2Active Not RecruitingTreatmentMarginal Zone B-Cell Lymphoma1
2Active Not RecruitingTreatmentMyasthenia Gravis1
2Active Not RecruitingTreatmentNephritis, Lupus1
2Active Not RecruitingTreatmentNon Hodgkin Lymphoma (NHL)1
2Active Not RecruitingTreatmentNon-Hodgkin's Lymphoma (NHL)5
2Active Not RecruitingTreatmentPrecursor Cell Lymphoblastic Leukemia-Lymphoma1
2Active Not RecruitingTreatmentPrimary Mediastinal Large B Cell Lymphoma1
2Active Not RecruitingTreatmentPrior Bortezomib Therapy Acceptable / Waldenstroms1
2Active Not RecruitingTreatmentRecurrent B-Cell Non-Hodgkin Lymphoma / Recurrent Chronic Lymphocytic Leukemia / Recurrent Indolent Adult Non-Hodgkin Lymphoma / Refractory B-Cell Non-Hodgkin Lymphoma1
2Active Not RecruitingTreatmentStage II Grade 1 Contiguous Follicular Lymphoma / Stage II Grade 1 Non-Contiguous Follicular Lymphoma / Stage II Grade 2 Contiguous Follicular Lymphoma / Stage II Grade 2 Non-Contiguous Follicular Lymphoma / Stage II Grade 3 Contiguous Follicular Lymphoma / Stage II Grade 3 Non-Contiguous Follicular Lymphoma / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Grade 3 Follicular Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Grade 3 Follicular Lymphoma1
2Active Not RecruitingTreatmentWaldenstrom's Macroglobulinemia (WM)4
2CompletedDiagnosticMalignant Lymphomas1
2CompletedDiagnosticRheumatoid Arthritis1
2CompletedPreventionPurpura, Thrombocytopenic, Idiopathic1
2CompletedTreatmentAIDS-Related Diffuse Large Cell Lymphoma / AIDS-related Immunoblastic Large Cell Lymphoma / AIDS-related Peripheral/Systemic Lymphoma / AIDS-related Small Noncleaved Cell Lymphoma1
2CompletedTreatmentANCA Associated Vasculitis / Systemic Lupus Erythematosus (SLE)1
2CompletedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Burkitt's Lymphoma1
2CompletedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Leukemias1
2CompletedTreatmentAdult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Hepatosplenic T-Cell Lymphoma / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Noncutaneous Extranodal Lymphoma / Peripheral T-Cell Lymphoma (PTCL) / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Small Lymphocytic Lymphoma / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / Testicular Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
2CompletedTreatmentAntiphospholipid Syndrome1
2CompletedTreatmentAplastic Anaemia (AA) / Congenital Hypoplastic Anemia / Red-Cell Aplasia, Pure1
2CompletedTreatmentAutoimmune Hemolytic Anemia / Cold type haemolytic anaemia1
2CompletedTreatmentAutoimmune Hemolytic Disease (Cold Type) (Warm Type)1
2CompletedTreatmentB-All / Burkitt's Lymphoma1
2CompletedTreatmentB-Cell Chronic Lymphocytic Leukemia / Stage I Chronic Lymphocytic Leukemia / Stage II Chronic Lymphocytic Leukemia / Stage III Chronic Lymphocytic Leukemia / Stage IV Chronic Lymphocytic Leukemia1
2CompletedTreatmentB-Chronic Lymphocytic Leukemia1
2CompletedTreatmentB-cell Chronic Lymphocytic Leukemia CLL1
2CompletedTreatmentBehcet's Syndrome1
2CompletedTreatmentBlood Stem Cell Transplant Failure / Leukemias / Malignancies, Hematologic1
2CompletedTreatmentBurkitt's Lymphoma / Burkitt'S-like Lymphoma1
2CompletedTreatmentCentral Nervous System Lymphoma1
2CompletedTreatmentChildhood Burkitt Lymphoma / Childhood Diffuse Large Cell Lymphoma / Childhood Immunoblastic Large Cell Lymphoma / Stage I Childhood Large Cell Lymphoma / Stage I Childhood Small Noncleaved Cell Lymphoma / Stage II Childhood Large Cell Lymphoma / Stage II Childhood Small Noncleaved Cell Lymphoma / Stage III Childhood Large Cell Lymphoma / Stage III Childhood Small Noncleaved Cell Lymphoma / Stage IV Childhood Large Cell Lymphoma / Stage IV Childhood Small Noncleaved Cell Lymphoma / Untreated Childhood Acute Lymphoblastic Leukemia1
2CompletedTreatmentChronic B-Lymphocytic Leukemia1
2CompletedTreatmentChronic Graft Versus Host Disease1
2CompletedTreatmentChronic Hepatitis C Infection / Vasculitis1
2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL)11
2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias3
2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Non-Hodgkin's Lymphoma (NHL)1
2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Small Lymphocytic Lymphoma (SLL)2
2CompletedTreatmentCold type haemolytic anaemia1
2CompletedTreatmentColonic Neoplasms / Neoplasms, Breast / Neoplasms, Lung / Neoplasms, Pancreatic / Stomach Neoplasms1
2CompletedTreatmentContiguous Stage II Adult Diffuse Large Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma1
2CompletedTreatmentContiguous Stage II Grade 1 Follicular Lymphoma / Contiguous Stage II Grade 2 Follicular Lymphoma / Contiguous Stage II Grade 3 Follicular Lymphoma / Contiguous Stage II Marginal Zone Lymphoma / Contiguous Stage II Small Lymphocytic Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Noncontiguous Stage II Grade 1 Follicular Lymphoma / Noncontiguous Stage II Grade 2 Follicular Lymphoma / Noncontiguous Stage II Grade 3 Follicular Lymphoma / Noncontiguous Stage II Marginal Zone Lymphoma / Noncontiguous Stage II Small Lymphocytic Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Splenic Marginal Zone Lymphoma / Stage I Grade 1 Follicular Lymphoma / Stage I Grade 2 Follicular Lymphoma / Stage I Grade 3 Follicular Lymphoma / Stage I Marginal Zone Lymphoma / Stage I Small Lymphocytic Lymphoma / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Grade 3 Follicular Lymphoma / Stage III Marginal Zone Lymphoma / Stage III Small Lymphocytic Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Grade 3 Follicular Lymphoma / Stage IV Marginal Zone Lymphoma / Stage IV Small Lymphocytic Lymphoma1
2CompletedTreatmentContiguous Stage II Grade 1 Follicular Lymphoma / Contiguous Stage II Grade 2 Follicular Lymphoma / Contiguous Stage II Marginal Zone Lymphoma / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Noncontiguous Stage II Grade 1 Follicular Lymphoma / Noncontiguous Stage II Grade 2 Follicular Lymphoma / Noncontiguous Stage II Marginal Zone Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Marginal Zone Lymphoma / Splenic Marginal Zone Lymphoma / Stage I Grade 1 Follicular Lymphoma / Stage I Grade 2 Follicular Lymphoma / Stage I Marginal Zone Lymphoma / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Marginal Zone Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Marginal Zone Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
2CompletedTreatmentContiguous Stage II Mantle Cell Lymphoma / Noncontiguous Stage II Mantle Cell Lymphoma / Stage I Mantle Cell Lymphoma / Stage III Mantle Cell Lymphoma / Stage IV Mantle Cell Lymphoma1
2CompletedTreatmentCutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Intraocular Lymphoma / Nodal marginal zone B-cell lymphomas / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Small Lymphocytic Lymphoma / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / Testicular Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
2CompletedTreatmentDermatomyositis / Juvenile Dermatomyositis / Muscle Inflammation / Polymyositis1
2CompletedTreatmentDiabetes, Diabetes Mellitus Type 11
2CompletedTreatmentDiabetic Nephropathies / Hypertension, Renal / IgA Glomerulonephritis / Kidney Failure,Chronic1
2CompletedTreatmentDiffuse Large Cell Lymphoma1
2CompletedTreatmentDiffuse Large Cell Lymphoma / Malignant Lymphomas / Mantle Cell Lymphoma (MCL) / Non-Hodgkin's Lymphoma (NHL) / Other Subtypes of B-cell Lymphoma / Transformed Lymphoma1
2CompletedTreatmentDiffuse, Mantle Cell Lymphoma, Lymphoma / Follicular Lymphoma (FL) / Large B-Cell, Diffuse / Lymphoma, Large Cell / Non-Hodgkin's Lymphoma (NHL)1
2CompletedTreatmentDisseminated Sclerosis2
2CompletedTreatmentExtranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Small Lymphocytic Lymphoma / Splenic Marginal Zone Lymphoma1
2CompletedTreatmentFocal Segmental Glomerulosclerosis (FSGS)1
2CompletedTreatmentFollicular Lymphoma (FL)9
2CompletedTreatmentFollicular Lymphoma (FL) / Lymphoma, B-Cell / Marginal Lymphoma1
2CompletedTreatmentFollicular T-NHL Lymphoma / Rituximab Maintenance1
2CompletedTreatmentDe Novo HLA Antibodies Development / Graft Function/Survival / Kidney Transplant Recipients / Transplant, Kidney1
2CompletedTreatmentGraft Versus Host Disease (GVHD)1
2CompletedTreatmentGraft Versus Host Disease (GVHD) / Scleroderma, Systemic1
2CompletedTreatmentHemophilia A1
2CompletedTreatmentHodgkin Lymphoma (Category) / Malignant Lymphomas1
2CompletedTreatmentHodgkins Disease (HD) / Non-Hodgkin's Lymphoma (NHL)1
2CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections / Lymphoma, AIDS Related1
2CompletedTreatmentHyposalivation / Keratoconjunctivitis Sicca / Primary Sjogren's Syndrome / Primary Sjögren's Syndrome / Tiredness / Xerostomia1
2CompletedTreatmentIdiopathic Thrombocytopenic Purpura (ITP)1
2CompletedTreatmentImmune Thrombocytopenic Purpura ( ITP )1
2CompletedTreatmentIndolent Non-Hodgkin's Lymphomas1
2CompletedTreatmentIndolent or Intermediate Grade B-cell Malignancy1
2CompletedTreatmentKidney Failure,Chronic / Transplantation, Kidney1
2CompletedTreatmentLeukemia, Lymphocytic, Acute1
2CompletedTreatmentLeukemia, Lymphocytic, Acute / Leukemia, Myelocytic, Acute / Leukemia,Myeloid, Chronic / Non-Hodgkin's Lymphoma (NHL)1
2CompletedTreatmentLeukemia, Lymphocytic / Mantle Cell Lymphoma (MCL)1
2CompletedTreatmentLeukemias11
2CompletedTreatmentLeukemias / Malignant Lymphomas14
2CompletedTreatmentLeukemias / Malignant Lymphomas / Multiple Myeloma (MM)1
2CompletedTreatmentLeukemias / Malignant Lymphomas / Multiple Myleoma / Myelodysplastic Syndrome / Myeloproliferative Disorders1
2CompletedTreatmentLow-grade B Cell Non-Hodgkin's Lymphoma / Mantle Cell Lymphoma Where Hematopoietic Stem Cell Transplantation is Not Indicated1
2CompletedTreatmentLupus Erythematosus, Systemic1
2CompletedTreatmentLymphocyte Predominant Hodgkin´s Lymphoma (LPHD)1
2CompletedTreatmentLymphocytic Leukemia, Chronic6
2CompletedTreatmentLymphocytic Leukemia, Chronic / Small Lymphocytic Lymphoma (SLL)1
2CompletedTreatmentLymphoma of Mucosa-Associated Lymphoid Tissue1
2CompletedTreatmentLymphoma of the Mucosa Associated Lymphoid Tissue (MALT)1
2CompletedTreatmentLymphoma, AIDS Related1
2CompletedTreatmentLymphoma, B Cell1
2CompletedTreatmentLymphoma, B-Cell2
2CompletedTreatmentLymphoma, B-Cell / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Non-Hodgkin's Lymphoma (NHL) / T-Cell Lymphomas1
2CompletedTreatmentLymphoma, Diffuse Large-Cell / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Malignant Lymphomas1
2CompletedTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)8
2CompletedTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL) / POOR PROGNOSIS1
2CompletedTreatmentLymphoma, Large Cell, Diffuse2
2CompletedTreatmentLymphoma, Low-Grade1
2CompletedTreatmentLymphoma, Mantle-Cell2
2CompletedTreatmentLymphoplasmacytic Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
2CompletedTreatmentMALT Lymphoma1
2CompletedTreatmentMALT Lymphoma / Non-Hodgkin's Lymphoma (NHL)1
2CompletedTreatmentMalignancies, Hematologic1
2CompletedTreatmentMalignant Lymphomas63
2CompletedTreatmentMalignant Lymphomas / Mantle Cell Lymphoma (MCL)1
2CompletedTreatmentMalignant Lymphomas / Non-Hodgkin's Lymphoma (NHL)1
2CompletedTreatmentMantle Cell Lymphoma (MCL)5
2CompletedTreatmentMantle Cell Lymphoma (MCL) / Non-Hodgkin's Lymphoma (NHL)1
2CompletedTreatmentMarginal Zone Lymphoma1
2CompletedTreatmentMultiple Myeloma (MM)1
2CompletedTreatmentMultiple Myeloma and Plasma Cell Neoplasm2
2CompletedTreatmentMuscle Inflammation / Myasthenia Gravis1
2CompletedTreatmentMyalgic Encephalomyelitis (ME)1
2CompletedTreatmentNon Hodgkin's Follicular Lymphoma1
2CompletedTreatmentNon-Germinal B-Cell-like (GCB) Diffuse Large B-cell Lymphoma (DLBCL)1
2CompletedTreatmentNon-Hodgkin's Lymphoma (CD20+)1
2CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)21
2CompletedTreatmentPemphigus1
2CompletedTreatmentPolyneuropathies1
2CompletedTreatmentPrimary Biliary Cirrhosis (PBC) / Tiredness1
2CompletedTreatmentPrimary Gastric Diffuse-Large B-Cell Lymphoma1
2CompletedTreatmentProgressive Multiple Sclerosis1
2CompletedTreatmentPurpura, Thrombocytopenic, Idiopathic1
2CompletedTreatmentRecurrent Mantle Cell Lymphoma1
2CompletedTreatmentRefractory Aggressive Non-Hodgkin's Lymphoma / Relapsing Aggressive Non-Hodgkin's Lymphoma1
2CompletedTreatmentRejection, Transplant1
2CompletedTreatmentRelapsed Follicular Lymphoma1
2CompletedTreatmentRelapsed Non-Hodgkin-Lymphoma1
2CompletedTreatmentRelapsed or Refractory Mantle Cell Lymphoma (MCL)1
2CompletedTreatmentRenal Failure1
2CompletedTreatmentRheumatoid Arthritis8
2CompletedTreatmentSarcoidosis1
2CompletedTreatmentStiff Person Syndrome1
2CompletedTreatmentSystemic Lupus Erythematosus (SLE)1
2CompletedTreatmentThrombotic Thrombocytopenic Purpura (TTP)1
2CompletedTreatmentUntreated T-Cell Angioimmunoblastic Lymphoma1
2CompletedTreatmentWaldenstrom's Macroglobulinemia (WM)2
2CompletedTreatmentWaldenstroms Macroglobulinemia1
2Not Yet RecruitingPreventionInvasive Pneumococcal Infection1
2Not Yet RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL)1
2Not Yet RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Burkitt Leukemia/Lymphoma / Hematopoietic/Lymphoid Cancer / Lymphoma, Lymphoblastic1
2Not Yet RecruitingTreatmentAggressive Non-Hodgkin Lymphoma1
2Not Yet RecruitingTreatmentAnti-NMDAR Encephalitis1
2Not Yet RecruitingTreatmentAutoimmune Encephalitis / Psychosis1
2Not Yet RecruitingTreatmentB Acute Lymphoblastic Leukemia / B Lymphoblastic Lymphoma / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent B Lymphoblastic Lymphoma / Recurrent T Lymphoblastic Leukemia/Lymphoma / Refractory B Lymphoblastic Lymphoma / Refractory T Lymphoblastic Lymphoma / T Acute Lymphoblastic Leukemia / T Lymphoblastic Lymphoma1
2Not Yet RecruitingTreatmentB-cell Non-Hodgkin's Lymphomas1
2Not Yet RecruitingTreatmentHematopoietic/Lymphoid Cancer1
2Not Yet RecruitingTreatmentHematopoietic/Lymphoid Cancer / Mantle Cell Lymphoma (MCL)1
2Not Yet RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)1
2Not Yet RecruitingTreatmentMarginal Zone Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Waldenstrom Macroglobulinemia / Waldenstrom's Macroglobulinemia (WM)1
2Not Yet RecruitingTreatmentSystemic Lupus Erythematosus Arthritis1
2RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Chronic Myeloid Leukemia (CML) / Granulocytic Sarcoma / Juvenile Myelomonocytic Leukemia (JMML) / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndromes (MDS) / Non-Hodgkin's Lymphoma (NHL)1
2RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Leukemias1
2RecruitingTreatmentAcute Lymphocytic Leukemia (ALL) / Adult Lymphoblastic Lymphoma1
2RecruitingTreatmentAdult Acute Lymphoblastic Leukemia / Adult Lymphoblastic Lymphoma / CD20 Positive / Philadelphia Chromosome Positive1
2RecruitingTreatmentAdult Diffuse Large B-Cell Lymphoma / B-cell Non-Hodgkin's Lymphomas / Lymphoma, B-Cell / Lymphoma, Large B-Cell, Diffuse (DLBCL)1
2RecruitingTreatmentAggressive Lymphoma / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Mantle Cell Lymphoma (MCL)1
2RecruitingTreatmentAmbulatory IPF1
2RecruitingTreatmentAnaplastic Large-Cell Lymphoma / Burkitt's Lymphoma / Gray Zone Lymphoma / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Primary mediastinal large B-cell lymphomas / Primary Meidastinal Lymphoma1
2RecruitingTreatmentAutoimmune Diseases / Glomerular Diseases / Glomerulonephritis minimal lesion / Glomerulonephritis, Membranous / Proteinuria1
2RecruitingTreatmentB-cell Non-Hodgkin's Lymphomas / Chronic Lymphocytic Leukaemia (CLL) / Follicular Lymphoma (FL) / Lymphoplasmacytic Lymphoma / Mantle Cell Lymphoma (MCL) / Marginal Zone Lymphoma / Recurrent Extranodal Marginal Zone Lymphoma of Mucosa-Associated Lymphoid Tissue / Refractory Extranodal Marginal Zone Lymphoma of Mucosa-Associated Lymphoid Tissue / Small Lymphocytic Lymphoma (SLL) / Waldenstrom's Macroglobulinemia (WM)1
2RecruitingTreatmentBurkitt's Lymphoma / Diffuse Large Cell Lymphoma / High Grade B-cell Lymphoma1
2RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL)1
2RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias1
2RecruitingTreatmentCryoglobulinemia / Systemic Vasculitis1
2RecruitingTreatmentEpstein Barr Virus Associated Hodgkin's Lymphoma / Epstein Barr Virus Associated Non Hodgkin's Lymphoma / Post-transplant Lymphoproliferative Disease (PTLD)1
2RecruitingTreatmentEpstein-Barr Virus-positive Diffuse Large B-cell Lymphoma1
2RecruitingTreatmentFollicular Lymphoma (FL)2
2RecruitingTreatmentFollicular Lymphoma (FL) / Malignant Lymphomas1
2RecruitingTreatmentFollicular Lymphoma, Grade 3b / Lymphoma, B-Cell / Lymphoma, Follicular, Grade 3b / Lymphoma, Large B-Cell, Diffuse (DLBCL)1
2RecruitingTreatmentFollicular Lymphoma, Grade 3b / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Transformed Lymphoma / DLBCL1
2RecruitingTreatmentGlomerulonephritis minimal lesion1
2RecruitingTreatmentHHV-8 / Human Immunodeficiency Virus (HIV) / Lymphoproliferative Disorders / Malignancies1
2RecruitingTreatmentHairy Cell Leukemia (HCL)2
2RecruitingTreatmentHeart / Lung Transplant / Lung Transplant1
2RecruitingTreatmentImmune Thrombocytopenia1
2RecruitingTreatmentLeukemia, Lymphocytic / Non-Hodgkin's Lymphoma (NHL) / Small Lymphocytic Lymphoma (SLL)1
2RecruitingTreatmentLeukemias7
2RecruitingTreatmentLeukemias / Malignant Lymphomas / Myeloproliferative Disorders / Plasma Cell Myeloma1
2RecruitingTreatmentLymphoma, AIDS Related / Lymphoma, Large B-Cell, Diffuse (DLBCL)1
2RecruitingTreatmentLymphoma, AIDS Related / Neoplasms, Brain1
2RecruitingTreatmentLymphoma, Hodgkins1
2RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)9
2RecruitingTreatmentLymphoma, Mantle-Cell1
2RecruitingTreatmentLymphoma, Mantle-Cell / Malignant Lymphomas1
2RecruitingTreatmentLymphomatoid Granulomatosis / Lymphoproliferative Disorders / Non-Hodgkin's Lymphoma (NHL)1
2RecruitingTreatmentMalignant Lymphomas5
2RecruitingTreatmentMalignant Lymphomas / Neurotoxicity / Therapy-Related Toxicity1
2RecruitingTreatmentMantle Cell Lymphoma (MCL)1
2RecruitingTreatmentMultiple Sclerosis, Chronic Progressive / Nervous System Diseases1
2RecruitingTreatmentNon-Hodgkin's Lymphoma (NHL)1
2RecruitingTreatmentPost-Transplant Lymphoproliferative Disorder / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent B-Cell Non-Hodgkin Lymphoma / Recurrent Burkitt Lymphoma / Refractory B-Cell Non-Hodgkin Lymphoma / Refractory Burkitt Lymphoma / Refractory Diffuse Large B-Cell Lymphoma1
2RecruitingTreatmentPrimary Central Nervous System Lymphoma (PCNSL)1
2RecruitingTreatmentPrimary Focal Segmental Glomerulosclerosis1
2RecruitingTreatmentRecurrent B-Cell Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood B-Lymphoblastic Lymphoma1
2RecruitingTreatmentRefractory Non-Hodgkin's lymphoma / Relapsed Non Hodgkin Lymphoma1
2RecruitingTreatmentRelapsed/Refractory Indolent B Cell Non-Hodgkin Lymphomas1
2RecruitingTreatmentRelapsed/Refractory Mantle Cell Lymphoma1
2RecruitingTreatmentSjögren's Syndrome1
2RecruitingTreatmentSystemic Sclerosis-Associated PAH / Systemic Sclerosis-Associated Pulmonary Arterial Hypertension1
2RecruitingTreatmentThrombotic Thrombocytopenic Purpura (TTP)1
2SuspendedTreatmentMalignant Lymphomas2
2TerminatedPreventionCardiac Allograft Vasculopathy / Heart Transplant Recipients1
2TerminatedSupportive CareChronic Myeloproliferative Disorders / Graft Versus Host Disease (GVHD) / Leukemias / Lymphoproliferative Disorders / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms1
2TerminatedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Chronic Myelogenous Leukemia (CML) / Granulocytic Sarcoma / Juvenile Myelomonocytic Leukemia (JMML) / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndromes (MDS) / Non-Hodgkin's Lymphoma (NHL)1
2TerminatedTreatmentAdult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Hepatosplenic T-Cell Lymphoma / Intraocular Lymphoma / Leukemia, Prolymphocytic / Nodal marginal zone B-cell lymphomas / Noncutaneous Extranodal Lymphoma / Peripheral T-Cell Lymphoma (PTCL) / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Small Lymphocytic Lymphoma / Refractory Chronic Lymphocytic Leukemia / Refractory Hairy Cell Leukemia / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / T-Cell Large Granular Lymphocyte Leukemia / Testicular Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
2TerminatedTreatmentAtypical Burkitt Lymphoma / Burkitt's Lymphoma / Non-Hodgkin's Lymphoma (NHL)1
2TerminatedTreatmentB-cell Childhood Acute Lymphoblastic Leukemia / Childhood Burkitt Lymphoma / Childhood Diffuse Large Cell Lymphoma / Childhood Immunoblastic Large Cell Lymphoma / L3 Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Large Cell Lymphoma / Recurrent Childhood Lymphoblastic Lymphoma / Recurrent Childhood Small Noncleaved Cell Lymphoma1
2TerminatedTreatmentB-cell Chronic Lymphocytic Leukemia (CLL) With 17p Deletion1
2TerminatedTreatmentBrain and Central Nervous System Tumors / Drug/Agent Toxicity by Tissue/Organ / Malignant Lymphomas / Thrombocytopenias1
2TerminatedTreatmentBurkitt's Lymphoma1
2TerminatedTreatmentBurkitt's Lymphoma / Non-Hodgkin's Lymphoma (NHL) / Primary Effusion Lymphomas1
2TerminatedTreatmentCancers1
2TerminatedTreatmentCancers / Non-Hodgkin's Lymphoma (NHL)1
2TerminatedTreatmentChronic Allograft Nephropathy (CAN) / Grafting / Transplantation, Kidney / Transplantation, Renal1
2TerminatedTreatmentChronic Lymphocytic Leukaemia (CLL)2
2TerminatedTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias1
2TerminatedTreatmentChronic Lymphocytic Leukaemia (CLL) / Lymphoma, B-Cell / Malignant Lymphomas / Non Hodgkin Lymphoma (NHL)1
2TerminatedTreatmentChronic Lymphocytic Leukaemia (CLL) / Small Lymphocytic Lymphoma (SLL)3
2TerminatedTreatmentChurg-Strauss Syndrome (CSS)1
2TerminatedTreatmentContiguous Stage II Adult Diffuse Large Cell Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Nodal marginal zone B-cell lymphomas / Noncontiguous Stage II Adult Diffuse Large Cell Lymphoma / Splenic Marginal Zone Lymphoma / Stage I Adult Diffuse Large Cell Lymphoma / Testicular Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
2TerminatedTreatmentContiguous Stage II Adult Diffuse Large Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma1
2TerminatedTreatmentDiabetes, Diabetes Mellitus Type 11
2TerminatedTreatmentFollicular Lymphoma (FL)6
2TerminatedTreatmentFollicular Lymphoma (FL) / Small Lymphocytic Lymphoma (SLL)1
2TerminatedTreatmentGiant Lymph Node Hyperplasia / Human Immunodeficiency Virus (HIV) Infections1
2TerminatedTreatmentGraft Versus Host Disease (GVHD)1
2TerminatedTreatmentLeukemia, Lymphocytic, Chronic / Small Lymphocytic Lymphoma (SLL)2
2TerminatedTreatmentLeukemia, Prolymphocytic / Leukemias1
2TerminatedTreatmentLeukemias1
2TerminatedTreatmentLeukemias / Lymphoma, Lymphoblastic / Malignant Lymphomas / Precursor-B Acute Lymphoblastic Leukemia1
2TerminatedTreatmentLeukemias / Malignant Lymphomas / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
2TerminatedTreatmentLymphoma, AIDS Related1
2TerminatedTreatmentLymphoma, B-Cell1
2TerminatedTreatmentLymphoma, B-Cell / Lymphoma, Diffuse / Non-Hodgkin's Lymphoma (NHL)1
2TerminatedTreatmentLymphoma, B-Cell / Lymphoma, Large B-Cell, Diffuse (DLBCL)1
2TerminatedTreatmentLymphoma, B-Cell / Non-Hodgkin's Lymphoma (NHL)2
2TerminatedTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)3
2TerminatedTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL) / Non-Hodgkin's Lymphoma (NHL)1
2TerminatedTreatmentLymphoma, Mantle-Cell1
2TerminatedTreatmentLymphoproliferative Disorders1
2TerminatedTreatmentMalignant Lymphomas9
2TerminatedTreatmentMantle Cell Lymphoma (MCL)1
2TerminatedTreatmentMultiple Myeloma and Plasma Cell Neoplasm1
2TerminatedTreatmentMyalgic Encephalomyelitis (ME)1
2TerminatedTreatmentNon-Hodgkin's Lymphoma (NHL)7
2TerminatedTreatmentPost-transplantation Lymphoproliferative Disorder1
2TerminatedTreatmentPrecancerous Conditions1
2TerminatedTreatmentPrimary Central Nervous System Non-Hodgkin Lymphoma1
2TerminatedTreatmentRecurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Small Lymphocytic Lymphoma1
2TerminatedTreatmentRheumatoid Arthritis3
2TerminatedTreatmentSickle Cell Disorders1
2TerminatedTreatmentStage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Grade 3 Follicular Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Grade 3 Follicular Lymphoma1
2TerminatedTreatmentWaldenstrom's Macroglobulinemia (WM)2
2Unknown StatusNot AvailableMalignant Lymphomas1
2Unknown StatusPreventionGraft Versus Host Disease (GVHD)1
2Unknown StatusPreventionTransplantation, Kidney1
2Unknown StatusSupportive CareChronic Myeloproliferative Disorders / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms1
2Unknown StatusTreatmentB-Cell Chronic Lymphocytic Leukemia1
2Unknown StatusTreatmentB-Cell Chronic Lymphocytic Leukemia / B-cell Non-Hodgkin's Lymphomas / Immunocytoma/Morbus Waldenström1
2Unknown StatusTreatmentB-cell Non Hodgkin's Lymphoma1
2Unknown StatusTreatmentChronic Lymphocytic Leukaemia (CLL) / CLL / First-Line / Front-line / Initial Therapy / Untreated1
2Unknown StatusTreatmentChronic Lymphocytic Leukaemia (CLL) / Stage I Chronic Lymphocytic Leukemia / Stage II Chronic Lymphocytic Leukemia / Stage III Chronic Lymphocytic Leukemia / Stage IV Chronic Lymphocytic Leukemia1
2Unknown StatusTreatmentDebilitating Fibrosing Skin Disorders (Localised Scleroderma, Eosinophilic Fasciitis)1
2Unknown StatusTreatmentEnd Stage Renal Disease (ESRD)1
2Unknown StatusTreatmentFollicular Lymphoma (FL)2
2Unknown StatusTreatmentFollicular Non-Hodgking´s Lymphoma Refractory or Relapsed After Treatment With R-chemotherapy in First Line1
2Unknown StatusTreatmentHemolytic-uremic Syndrome (HUS) / Thrombotic Thrombocytopenic Purpura (TTP)1
2Unknown StatusTreatmentIndolent Non Hodgkin Lymphoma1
2Unknown StatusTreatmentLeukemias1
2Unknown StatusTreatmentLymphoma, High-Grade1
2Unknown StatusTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)6
2Unknown StatusTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL) / Non-Hodgkin's Lymphoma (NHL)2
2Unknown StatusTreatmentLymphoma, Mantle-Cell2
2Unknown StatusTreatmentMalignant Lymphomas14
2Unknown StatusTreatmentMalignant Melanoma of Skin Stage III / Metastatic Melanoma1
2Unknown StatusTreatmentNHL With Hemophagocytic Lymphohistiocytosis1
2Unknown StatusTreatmentNeuroblastomas / Opsoclonus-Myoclonus1
2Unknown StatusTreatmentNo Hodgkin B Lymphoma1
2Unknown StatusTreatmentNon-Hodgkin's Lymphoma (NHL)3
2Unknown StatusTreatmentPeripheral Neuropathy1
2Unknown StatusTreatmentPrimary Disease / Pulmonary Alveolar Proteinosis (PAP)1
2Unknown StatusTreatmentPrimary Non Hodgkin Lymphoma of the Central Nervous System2
2Unknown StatusTreatmentSteroid-Refractory Chronic GVHD1
2Unknown StatusTreatmentThrombotic Thrombocytopenic Purpura (TTP)1
2Unknown StatusTreatmentWaldenstrom's Macroglobulinemia (WM)1
2WithdrawnTreatmentActive Chronic Graft Versus Host Disease1
2WithdrawnTreatmentAdult Non-Hodgkin's Lymphoma / Anaplastic Large Cell Lymphoma / Lymphoma, AIDS Related1
2WithdrawnTreatmentAlogenic Hematopoietic Transplant / Graft Versus Host Disease (GVHD)1
2WithdrawnTreatmentB-Cell Chronic Lymphocytic Leukemia / Refractory Chronic Lymphocytic Leukemia1
2WithdrawnTreatmentB-cell Adult Acute Lymphoblastic Leukemia / Blastic Phase Chronic Myelogenous Leukemia / Chronic Myelogenous Leukemia, BCR-ABL1 Positive / Philadelphia Chromosome Positive Adult Precursor Acute Lymphoblastic Leukemia / Untreated Adult Acute Lymphoblastic Leukemia1
2WithdrawnTreatmentChronic Lymphocytic Leukaemia (CLL)1
2WithdrawnTreatmentContiguous Stage II Adult Diffuse Large Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Large Cell Lymphoma / Stage I Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma1
2WithdrawnTreatmentFollicular Lymphoma (FL) / Grey Zone Lymphoma / High Grade B Cell Lymphoma / Lymphoma, Large B-Cell, Diffuse (DLBCL) / Marginal Zone Lymphoma / Mediastinal Large B-cell Lymphoma / Small Lymphocytic Lymphoma (SLL)1
2WithdrawnTreatmentGranulomatous and Lymphocytic Interstitial Lung Disease1
2WithdrawnTreatmentIdiopathic Pulmonary Fibrosis (IPF)1
2WithdrawnTreatmentIdiopathic Thrombocytopenic Purpura (ITP)1
2WithdrawnTreatmentLeukemias3
2WithdrawnTreatmentLeukemias / Malignant Lymphomas1
2WithdrawnTreatmentLeukemias / Multiple Myeloma and Plasma Cell Neoplasm1
2WithdrawnTreatmentLupus Erythematosus, Systemic1
2WithdrawnTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)1
2WithdrawnTreatmentMalignant Lymphomas8
2WithdrawnTreatmentScleroderma, Systemic1
2WithdrawnTreatmentSystemic Lupus Erythematosus (SLE)1
2, 3Active Not RecruitingTreatmentChildhood B Acute Lymphoblastic Leukemia / Childhood Burkitt Leukemia / Childhood Diffuse Large Cell Lymphoma / Mediastinal (Thymic) Large B-Cell Lymphoma / Stage III Childhood Large Cell Lymphoma / Stage IV Childhood Large Cell Lymphoma1
2, 3Active Not RecruitingTreatmentIdiopathic Membranous Nephropathy1
2, 3Active Not RecruitingTreatmentLung Diseases, Interstitial / Pneumonitis, Interstitial1
2, 3Active Not RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)1
2, 3Active Not RecruitingTreatmentSclerosis, Progressive Systemic1
2, 3CompletedHealth Services ResearchPemphigus1
2, 3CompletedTreatmentAnemia, Hemolytic, Autoimmune / Idiopathic Thrombocytopenic Purpura (ITP)1
2, 3CompletedTreatmentChildhood Idiopathic Nephrotic Syndrome1
2, 3CompletedTreatmentDisseminated Sclerosis1
2, 3CompletedTreatmentGlomerulonephritis membranous1
2, 3CompletedTreatmentGranulomatosis With Polyangiitis / Microscopic Polyangiitis / Vasculitis1
2, 3CompletedTreatmentImmune Thrombocytopenic Purpura ( ITP )1
2, 3CompletedTreatmentLupus Erythematosus, Systemic1
2, 3CompletedTreatmentMyalgic Encephalomyelitis (ME)1
2, 3CompletedTreatmentNeuromyelitis Optica Spectrum Disorder1
2, 3CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)1
2, 3CompletedTreatmentOphthalmopathy, Thyroid-Associated1
2, 3CompletedTreatmentSjögren's Syndrome1
2, 3CompletedTreatmentTransplantation, Kidney1
2, 3CompletedTreatmentUlcerative Colitis (UC)1
2, 3RecruitingTreatmentIdiopathic Inflammatory Myositis / Interstitial Lung Disease (ILD) / Mixed Connective Tissue Disease (MCTD) / Scleroderma1
2, 3RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)2
2, 3RecruitingTreatmentMature B-Cell Lymphoma1
2, 3RecruitingTreatmentMature B-cell Non-Hodgkin Lymphoma1
2, 3TerminatedTreatmentFollicular Lymphoma (FL) / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma1
2, 3TerminatedTreatmentHemophilia A1
2, 3TerminatedTreatmentLupus Erythematosus, Systemic1
2, 3Unknown StatusTreatmentAnkylosing Spondylitis (AS)1
2, 3Unknown StatusTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)1
2, 3Unknown StatusTreatmentSteroid Dependent Nephrotic Syndrome / Steroid Resistant Nephrotic Syndrome1
3Active Not RecruitingTreatmentANCA-associated Vasculitides1
3Active Not RecruitingTreatmentAnemias / Chronic Lymphocytic Leukaemia (CLL) / Fever, Sweats, and Hot Flashes / Hepatomegaly / Lymphadenopathy / Lymphocytosis / Small Lymphocytic Lymphoma (SLL) / Splenomegaly / Stage I Chronic Lymphocytic Leukemia / Stage I Small Lymphocytic Lymphoma / Stage II Chronic Lymphocytic Leukemia / Stage II Small Lymphocytic Lymphoma / Stage III Chronic Lymphocytic Leukemia / Stage III Small Lymphocytic Lymphoma / Stage IV Chronic Lymphocytic Leukemia / Stage IV Small Lymphocytic Lymphoma / Thrombocytopenias / Tiredness / Weight Changes1
3Active Not RecruitingTreatmentAnti-Neutrophil Cytoplasmic Antibody-Associated Vasculitis / Granulomatosis With Polyangiitis / Microscopic Polyangiitis1
3Active Not RecruitingTreatmentB-cell Non Hodgkin's Lymphoma / Mature B-cell Leukemia Burkitt-type1
3Active Not RecruitingTreatmentCD19 Positive / CD20 Positive / CD5 Positive / Stage I Chronic Lymphocytic Leukemia / Stage II Chronic Lymphocytic Leukemia / Stage III Chronic Lymphocytic Leukemia / Stage IV Chronic Lymphocytic Leukemia1
3Active Not RecruitingTreatmentCD20+ Aggressive Lymphoma, Mantle Cell Lymphoma1
3Active Not RecruitingTreatmentChronic Fatigue Syndrome/ Myalgic Encephalitis (CFS/ME)1
3Active Not RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL)3
3Active Not RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias1
3Active Not RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL) / Small Lymphocytic Lymphoma (SLL)2
3Active Not RecruitingTreatmentDe Novo DLBCL / DLBCL Transformed From Indolent Lymphoma / Follicular Grade 3 Lymphoma / Lymphoma, Large B-Cell, Diffuse (DLBCL)1
3Active Not RecruitingTreatmentDiffuse Large B Cell Lymphoma CD20 Positive / Diffuse Large B Cell Lymphoma CD20+1
3Active Not RecruitingTreatmentFollicular Lymphoma (FL)5
3Active Not RecruitingTreatmentFollicular Lymphoma (FL) / Lymphoma, Intermediate-Grade / Lymphoma, Low-Grade1
3Active Not RecruitingTreatmentFollicular Lymphoma (FL) / Lymphoplasmacytic Lymphoma / Marginal Zone Lymphoma / Small Lymphocytic Lymphoma (SLL)1
3Active Not RecruitingTreatmentGranulomatosis With Polyangiitis / Microscopic Polyangiitis / Renal Limited Forms1
3Active Not RecruitingTreatmentIdiopathic Thrombocytopenic Purpura (ITP)1
3Active Not RecruitingTreatmentIndolent Cutaneous B Cell Lymphomas1
3Active Not RecruitingTreatmentLarge B Cell Lymphoma1
3Active Not RecruitingTreatmentLeukemias1
3Active Not RecruitingTreatmentLymphocytic Leukemia, Chronic3
3Active Not RecruitingTreatmentLymphoma, B-Cell / Lymphoma, Large B-Cell, Diffuse (DLBCL)1
3Active Not RecruitingTreatmentLymphoma, Hodgkins2
3Active Not RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)1
3Active Not RecruitingTreatmentLymphoma, Mantle-Cell1
3Active Not RecruitingTreatmentLymphoma, Mucosa-Associated Lymphoid Tissue1
3Active Not RecruitingTreatmentMalignant Lymphomas9
3Active Not RecruitingTreatmentMalignant Lymphomas / Non-Hodgkin's Lymphoma (NHL)1
3Active Not RecruitingTreatmentMantle Cell Lymphoma (MCL)2
3Active Not RecruitingTreatmentMantle Cell Lymphoma (MCL) / Non-Hodgkin's Lymphoma (NHL)1
3Active Not RecruitingTreatmentNon-Hodgkin's Lymphoma (NHL)4
3Active Not RecruitingTreatmentRheumatoid Arthritis1
3Active Not RecruitingTreatmentWaldenstrom's Macroglobulinemia (WM)1
3Active Not RecruitingTreatmentWarm Autoimmune Hemolytic Anemia1
3CompletedNot AvailablePemphigus1
3CompletedTreatmentAnemia, Hemolytic, Autoimmune1
3CompletedTreatmentB-Cell Chronic Lymphocytic Leukemia1
3CompletedTreatmentBullous Pemphigoid (BP)1
3CompletedTreatmentChronic Lymphocytic Leukaemia (CLL)2
3CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias1
3CompletedTreatmentDiffuse Large B-Cell Lymphoma, Non-Hodgkin's Lymphoma1
3CompletedTreatmentElderly Patients (>65 Years) / Lymphoma, Large B-Cell, Diffuse (DLBCL)1
3CompletedTreatmentFSGS / Proteinuria1
3CompletedTreatmentFollicular Lymphoma (FL)2
3CompletedTreatmentFollicular Lymphoma (FL) / Immunocytomas / Lymphocytic Lymphomas / Marginal Zone Lymphomas / Non-Hodgkin's Lymphoma (NHL)1
3CompletedTreatmentFollicular NHL Grade 3b / Lymphoma, Large B-Cell, Diffuse (DLBCL)1
3CompletedTreatmentGlomerulonephritis minimal lesion2
3CompletedTreatmentGranulomatosis With Polyangiitis / Microscopic Polyangiitis1
3CompletedTreatmentIdiopathic Thrombocytopenic Purpura (ITP)1
3CompletedTreatmentIdiopathic Thrombocytopenic Purpura (ITP) / Purpura1
3CompletedTreatmentImmune Thrombocytopenia (ITP)1
3CompletedTreatmentLeukemia, Lymphocytic1
3CompletedTreatmentLeukemias3
3CompletedTreatmentLow-Grade or Follicular B-Cell Non-Hodgkin's Lymphoma1
3CompletedTreatmentLymphocytic Leukemia, Chronic1
3CompletedTreatmentLymphoma, B-Cell / Lymphoma, Large-Cell, Immunoblastic / Non-Hodgkin's Lymphoma (NHL)1
3CompletedTreatmentLymphoma, Diffuse Large-Cell1
3CompletedTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)3
3CompletedTreatmentLymphoma, Large-Cell, Diffuse2
3CompletedTreatmentMalignant Lymphomas14
3CompletedTreatmentMantle Cell Lymphoma (MCL)1
3CompletedTreatmentMantle Cell Lymphoma (MCL) / Non-Hodgkin's Lymphoma (NHL)1
3CompletedTreatmentNephritis, Lupus1
3CompletedTreatmentNon Hodgkin Lymphoma (NHL)1
3CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)7
3CompletedTreatmentPemphigus Disease1
3CompletedTreatmentPneumonitis, Interstitial / Rheumatoid Arthritis1
3CompletedTreatmentPolyneuropathies1
3CompletedTreatmentRheumatoid Arthritis20
3CompletedTreatmentStage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Grade 3 Follicular Lymphoma / Stage III Small Lymphocytic Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Grade 3 Follicular Lymphoma / Stage IV Small Lymphocytic Lymphoma1
3Not Yet RecruitingTreatmentDisseminated Sclerosis1
3Not Yet RecruitingTreatmentImmune Thrombocytopenia1
3Not Yet RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)2
3Not Yet RecruitingTreatmentMembranoproliferative Glomerulonephritis1
3Not Yet RecruitingTreatmentSevere Forms of Mucous Membrane Pemphigoid1
3RecruitingSupportive CareFollicular Lymphoma (FL) / Marginal Zone Lymphoma / Mucosal-Associated Lymphoid Tissue Lymphoma / Small Lymphocytic Lymphoma (SLL)1
3RecruitingTreatmentANCA-Associated Vasculitis (AAV)1
3RecruitingTreatmentAcquired Haemophilia1
3RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Adult B Acute Lymphoblastic Leukemia / B Acute Lymphoblastic Leukemia, Philadelphia Chromosome Negative / BCR/ABL1 Fusion Protein Negative / Untreated Adult Acute Lymphoblastic Leukemia1
3RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Lymphoma, Lymphoblastic1
3RecruitingTreatmentB Acute Lymphoblastic Leukemia1
3RecruitingTreatmentB-cell Non Hodgkin's Lymphoma1
3RecruitingTreatmentCD20 Positive / Mantle Cell Lymphoma (MCL)1
3RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL)2
3RecruitingTreatmentEosinophilic Granulomatosis With Polyangiitis (EGPA)1
3RecruitingTreatmentFollicular Lymphoma (FL)6
3RecruitingTreatmentFollicular Lymphoma (FL) / Immunocytomas / Lymphocytic Lymphomas / Mantle-Cell Lymphomas / Marginal Zone Lymphomas / Non-Hodgkin's Lymphoma (NHL)1
3RecruitingTreatmentFollicular Non-Hodgkin's Lymphoma1
3RecruitingTreatmentFollicular Non-Hodgkin's Lymphoma / Nodal Marginal Zone Lymphoma / Splenic Marginal Zone Lymphoma1
3RecruitingTreatmentGeneralized Myasthenia Gravis1
3RecruitingTreatmentGlomerulonephritis membranous1
3RecruitingTreatmentGlomerulonephritis, Membranous1
3RecruitingTreatmentGraft Versus Host Disease (GVHD)1
3RecruitingTreatmentLung Diseases, Interstitial1
3RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)6
3RecruitingTreatmentLymphoma,Non-Hodgkin1
3RecruitingTreatmentMantle Cell Lymphoma (MCL)3
3RecruitingTreatmentNeuroblastomas / Opsoclonus Myoclonus Syndrome1
3RecruitingTreatmentNon-Hodgkin's Lymphoma (NHL)4
3RecruitingTreatmentPemphigus Vulgaris (PV)1
3RecruitingTreatmentPrimary Central Nervous System Lymphoma (PCNSL)1
3RecruitingTreatmentPurpura, Thrombocytopenic, Idiopathic1
3RecruitingTreatmentRelapsing Remitting Multiple Sclerosis (RRMS)1
3RecruitingTreatmentRheumatoid Arthritis3
3RecruitingTreatmentStage I Grade 1 Follicular Lymphoma / Stage I Grade 2 Follicular Lymphoma / Stage II Grade 1 Contiguous Follicular Lymphoma / Stage II Grade 1 Non-Contiguous Follicular Lymphoma / Stage II Grade 2 Contiguous Follicular Lymphoma / Stage II Grade 2 Non-Contiguous Follicular Lymphoma / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma1
3RecruitingTreatmentTreatment Naive Follicular Lymphoma1
3RecruitingTreatmentWaldenstrom's Macroglobulinemia (WM)1
3SuspendedTreatmentMalignant Lymphomas1
3SuspendedTreatmentSystemic Lupus Erythematosus, Lupus Nephritis1
3TerminatedHealth Services ResearchFollicular Lymphoma (FL)1
3TerminatedTreatmentAcute Rejection1
3TerminatedTreatmentCD20-Positive Large B-Cell Lymphoma1
3TerminatedTreatmentChronic Lymphocytic Leukaemia (CLL)1
3TerminatedTreatmentDiffuse Large Cell Lymphoma1
3TerminatedTreatmentFollicular Lymphoma (FL)2
3TerminatedTreatmentFollicular Lymphoma (FL) / Lymphoma, Low-Grade / Lymphoma, Mixed-Cell, Follicular / Lymphoma, Small Cleaved-Cell, Follicular1
3TerminatedTreatmentFrequent Relapsing Nephrotic Syndrome / Steroid Dependent Nephrotic Syndrome1
3TerminatedTreatmentIndolent Non-Hodgkin's Lymphomas2
3TerminatedTreatmentLymphoma, B Cell1
3TerminatedTreatmentLymphoma, B-Cell1
3TerminatedTreatmentMalignant Lymphomas2
3TerminatedTreatmentNephritis, Lupus1
3TerminatedTreatmentNon-Hodgkin's Lymphoma (NHL)5
3TerminatedTreatmentRecurrent Diffuse Large B-Cell Lymphoma / Refractory Diffuse Large B-Cell Lymphoma1
3TerminatedTreatmentThrombotic Thrombocytopenic Purpura (TTP)1
3Unknown StatusTreatmentAggressive B Cell Lymphoma1
3Unknown StatusTreatmentBurkitt's Lymphoma1
3Unknown StatusTreatmentChronic Lymphocytic Leukaemia (CLL)1
3Unknown StatusTreatmentFollicular Lymphoma (FL)2
3Unknown StatusTreatmentHumoral Rejection in Kidney Transplantation1
3Unknown StatusTreatmentIPI≥2 / Lymphoma, Large B-Cell, Diffuse (DLBCL)1
3Unknown StatusTreatmentLeukemias / Malignant Lymphomas1
3Unknown StatusTreatmentLeukemias / Mucositis / Oral Complications1
3Unknown StatusTreatmentLymphoma, Mantle-Cell1
3Unknown StatusTreatmentMalignant Lymphomas3
3Unknown StatusTreatmentPemphigus1
3Unknown StatusTreatmentRejection, Transplant1
3Unknown StatusTreatmentRheumatoid Arthritis1
3WithdrawnTreatmentFollicular Lymphoma (FL) / Indolent Non-Hodgkin's Lymphomas / Marginal Zone Lymphoma / Small Lymphocytic Lymphoma (SLL)1
3WithdrawnTreatmentImmune Thrombocytopenia1
3WithdrawnTreatmentMantle Cell Lymphoma (MCL)1
3WithdrawnTreatmentNephritis, Lupus1
4Active Not RecruitingTreatmentGranulomatosis With Polyangiitis / Microscopic Polyangiitis1
4CompletedPreventionAutoimmune Adrenocortical Failure1
4CompletedPreventionTransplantation, Kidney1
4CompletedTreatmentAcute Lymphoblastic Leukaemias (ALL)1
4CompletedTreatmentAdult Acute Lymphocytic Leukemia1
4CompletedTreatmentBurkitt's Lymphoma / Large Cell Anaplastic Lymphoma / Lymphoma, Lymphoblastic / Mediastinal Neoplasms1
4CompletedTreatmentDMARD Resistant Rheumatoid Arthritis1
4CompletedTreatmentGlycogen Storage Disease Type II / Pompe's Disease1
4CompletedTreatmentHLA Sensitization1
4CompletedTreatmentIgA Nephropathy1
4CompletedTreatmentImmune Thrombocytopenia / Purpura, Thrombocytopenic, Idiopathic1
4CompletedTreatmentImmunosuppression / Rejection, Transplant / Transplantation, Kidney1
4CompletedTreatmentLymphocytic Leukemia, Chronic3
4CompletedTreatmentNon Burkitt / Post-transplant Lymphoproliferative Disease (PTLD)1
4CompletedTreatmentNon Hodgkin Lymphoma (NHL)1
4CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)2
4CompletedTreatmentRheumatoid Arthritis12
4Not Yet RecruitingTreatmentEosinophilic Granulomatosis With Polyangiitis1
4RecruitingTreatmentAnti-Neutrophil Cytoplasmic Antibody-Associated Vasculitis1
4RecruitingTreatmentAnti-Neutrophil Cytoplasmic Antibody-Associated Vasculitis / Granulomatosis With Polyangiitis / Microscopic Polyangiitis1
4RecruitingTreatmentFunction of Renal Transplant1
4RecruitingTreatmentGlomerulonephritis minimal lesion1
4RecruitingTreatmentGlycogen Storage Disease Type II (GSD-II) / Glycogenesis 2 Acid Maltase Deficiency / Pompe's Disease1
4RecruitingTreatmentGranulomatosis With Polyangiitis (Wegener's Granulomatosis)1
4RecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)1
4RecruitingTreatmentMantle Cell Lymphoma (MCL)1
4RecruitingTreatmentOphthalmopathy, Thyroid-Associated1
4RecruitingTreatmentPompe's Disease1
4RecruitingTreatmentRecurrent IgA Nephropathy1
4RecruitingTreatmentRheumatoid Arthritis1
4RecruitingTreatmentWaldenstrom's Macroglobulinemia (WM)1
4RecruitingTreatmentWegener's Granulomatosis or Microscopic Polyangiitis / Wegener's Granulomatosis, Microscopic Polyangiitis1
4TerminatedPreventionImpaired Renal Function1
4TerminatedTreatmentRheumatoid Arthritis1
4Unknown StatusScreeningNon-Hodgkin's Lymphoma (NHL)1
4Unknown StatusTreatmentAcute Lymphoblastic Leukaemias (ALL) / Non-Hodgkin's Lymphoma (NHL)1
4Unknown StatusTreatmentAdult Acute Lymphocytic Leukemia1
4Unknown StatusTreatmentChronic Lymphocytic Leukaemia (CLL)1
4Unknown StatusTreatmentDiabetes, Diabetes Mellitus Type 11
Not AvailableActive Not RecruitingNot AvailableGranulomatosis With Polyangiitis / Microscopic Polyangiitis / Wegener's Granulomatosis, Microscopic Polyangiitis1
Not AvailableActive Not RecruitingNot AvailableNon-Hodgkin's Lymphoma (NHL) / Non-Hodgkin's Lymphoma, Lymphoma, Follicular1
Not AvailableActive Not RecruitingTreatmentHodgkins Disease (HD) / Malignant Lymphomas1
Not AvailableApproved for MarketingNot AvailableChronic Lymphocytic Leukaemia (CLL)1
Not AvailableCompletedNot AvailableFollicular Lymphoma (FL)4
Not AvailableCompletedNot AvailableImmune Thrombocytopenia1
Not AvailableCompletedNot AvailableLymphocytic Leukemia, Chronic2
Not AvailableCompletedNot AvailableLymphoma, Lymphoma, Large B-Cell, Diffuse, Non-Hodgkin's Lymphoma, Lymphoma, Non Hodgkin, Relapsed or Refractory Diffuse Large B-Cell Lymphoma1
Not AvailableCompletedNot AvailableLymphomas: Non-Hodgkin / Lymphomas: Non-Hodgkin Cutaneous Lymphoma / Lymphomas: Non-Hodgkin Diffuse Large B-Cell / Lymphomas: Non-Hodgkin Follicular / Indolent B-Cell / Lymphomas: Non-Hodgkin Mantle Cell / Lymphomas: Non-Hodgkin Marginal Zone / Lymphomas: Non-Hodgkin Peripheral T-Cell / Lymphomas: Non-Hodgkin Waldenstr Macroglobulinemia / Non-Hodgkin's Lymphoma (NHL)1
Not AvailableCompletedNot AvailableMalignant Lymphomas2
Not AvailableCompletedNot AvailableNon-Hodgkin's Lymphoma (NHL)1
Not AvailableCompletedNot AvailableRelapsed or Refractory Chronic Lymphoproliferative Disorders1
Not AvailableCompletedNot AvailableRheumatoid Arthritis8
Not AvailableCompletedNot AvailableWaldenstrom's Macroglobulinemia (WM)1
Not AvailableCompletedTreatmentAtopic Dermatitis (AD)1
Not AvailableCompletedTreatmentBrain and Central Nervous System Tumors / Malignant Lymphomas1
Not AvailableCompletedTreatmentChurg-Strauss Syndrome (CSS) / Granulomatosis With Polyangiitis / Microscopic Polyangiitis1
Not AvailableCompletedTreatmentDisseminated Sclerosis1
Not AvailableCompletedTreatmentEndothelial Function / Inflammatory Reaction / Rheumatoid Arthritis1
Not AvailableCompletedTreatmentGraft Versus Host Disease (GVHD)1
Not AvailableCompletedTreatmentHodgkins Disease (HD) / Leukemias / Myelodysplastic Syndrome / Non-Hodgkin's Lymphoma (NHL)1
Not AvailableCompletedTreatmentImmune Thrombocytopenic Purpura ( ITP )1
Not AvailableCompletedTreatmentKidney Transplant Rejection1
Not AvailableCompletedTreatmentLeukemias / Malignant Lymphomas2
Not AvailableCompletedTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL) / Post Transplant Lymphoproliferative Disorder / Primary Mediastinal (Thymic) Large B-cell Lymphoma1
Not AvailableCompletedTreatmentLymphoma, Large-Cell, Diffuse1
Not AvailableCompletedTreatmentMalignant Lymphomas7
Not AvailableCompletedTreatmentMalignant Lymphomas / Non-Hodgkin's Lymphoma (NHL)1
Not AvailableCompletedTreatmentNon Hodgkin Lymphoma (NHL)1
Not AvailableCompletedTreatmentNon-Hodgkin's Lymphoma (NHL)1
Not AvailableCompletedTreatmentRheumatoid Arthritis1
Not AvailableRecruitingNot AvailableAnkylosing Spondylitis (AS) / Psoriatic Arthritis / Rheumatoid Arthritis1
Not AvailableRecruitingNot AvailableChronic Lymphocytic Leukaemia (CLL)2
Not AvailableRecruitingNot AvailableLeukemia, Lymphocytic, Chronic, B-Cell / Non-Hodgkin's Lymphoma (NHL)1
Not AvailableRecruitingNot AvailableOff-Label Use1
Not AvailableRecruitingNot AvailablePompe's Disease1
Not AvailableRecruitingNot AvailableRelapsing Remitting Multiple Sclerosis (RRMS)1
Not AvailableRecruitingTreatmentAIDS Related Non-Hodgkin Lymphoma / AIDS-Related Burkitt Lymphoma / AIDS-Related Diffuse Large B-cell Lymphoma / AIDS-Related Plasmablastic Lymphoma / AIDS-Related Primary Effusion Lymphoma / Human Immunodeficiency Virus (HIV) Infections1
Not AvailableRecruitingTreatmentComposite Lymphoma / Grade 3b Follicular Lymphoma / Stage I Diffuse Large B-Cell Lymphoma / Stage I Follicular Lymphoma / Stage II Diffuse Large B-Cell Lymphoma / Stage II Follicular Lymphoma / Stage III Diffuse Large B-Cell Lymphoma / Stage III Follicular Lymphoma / Stage IV Diffuse Large B-Cell Lymphoma / Stage IV Follicular Lymphoma1
Not AvailableRecruitingTreatmentLymphoma, Hodgkins / Non-Hodgkin's Lymphoma (NHL)1
Not AvailableRecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL)1
Not AvailableRecruitingTreatmentLymphoma, Large B-Cell, Diffuse (DLBCL) / Non Hodgkin Lymphoma (NHL)1
Not AvailableRecruitingTreatmentMalignant Lymphomas1
Not AvailableTerminatedNot AvailableMalignant Lymphomas / Non-Hodgkin's Lymphoma (NHL)1
Not AvailableTerminatedTreatmentAcute Lymphoblastic Leukaemias (ALL) / All / Leukemias1
Not AvailableTerminatedTreatmentAcute Rejection / Transplantation, Renal1
Not AvailableTerminatedTreatmentContiguous Stage II Adult Diffuse Large Cell Lymphoma / Noncontiguous Stage II Adult Diffuse Large Cell Lymphoma / Stage I Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma1
Not AvailableTerminatedTreatmentMalignant Lymphomas1
Not AvailableTerminatedTreatmentSickle Cell Disorders / Sickle Cell-hemoglobin C Disease / Sickle Cell-β0-thalassemia1
Not AvailableUnknown StatusNot AvailableAcquired Haemophilia1
Not AvailableUnknown StatusNot AvailableChronic Lymphocytic Leukaemia (CLL)1
Not AvailableUnknown StatusNot AvailableMalignant Lymphomas1
Not AvailableUnknown StatusNot AvailableScleritis / Uveitis1
Not AvailableUnknown StatusSupportive CareNon-Hodgkin's Lymphoma (NHL)1
Not AvailableUnknown StatusTreatmentBlood and Marrow Transplant (BMT) / Graft Versus Host Disease (GVHD)1
Not AvailableUnknown StatusTreatmentMalignant Lymphomas1
Not AvailableUnknown StatusTreatmentPemphigus1
Not AvailableWithdrawnNot AvailablePurpura, Thrombocytopenic, Idiopathic1
Not AvailableWithdrawnDiagnosticMalignant Lymphomas1
Not AvailableWithdrawnTreatmentAplastic Anaemia (AA)1
Not AvailableWithdrawnTreatmentEnd Stage Renal Disease (ESRD)1
Not AvailableWithdrawnTreatmentNephritis, Lupus1

Pharmacoeconomics

Manufacturers
  • Roche
Packagers
Dosage forms
FormRouteStrength
Injection, solutionIntravenous10 mg/mL
SolutionIntravenous10 mg
Injection, solutionSubcutaneous
SolutionSubcutaneous120 mg
Prices
Unit descriptionCostUnit
Rituxan 10 mg/ml Concentrate 10ml Vial708.17USD vial
Rituxan 10 mg/ml vial68.09USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2149329 No2008-07-152013-11-12Canada
CA1336826 No1995-08-292012-08-29Canada
US5736137 No1998-04-072015-04-07Us

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.414Not Available
isoelectric point8.68Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent...
Gene Name
FCGR3B
Uniprot ID
O75015
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-B
Molecular Weight
26215.64 Da
References
  1. Treon SP, Hansen M, Branagan AR, Verselis S, Emmanouilides C, Kimby E, Frankel SR, Touroutoglou N, Turnbull B, Anderson KC, Maloney DG, Fox EA: Polymorphisms in FcgammaRIIIA (CD16) receptor expression are associated with clinical response to rituximab in Waldenstrom's macroglobulinemia. J Clin Oncol. 2005 Jan 20;23(3):474-81. [PubMed:15659493 ]
  2. Bowles JA, Weiner GJ: CD16 polymorphisms and NK activation induced by monoclonal antibody-coated target cells. J Immunol Methods. 2005 Sep;304(1-2):88-99. [PubMed:16109421 ]
  3. Bowles JA, Wang SY, Link BK, Allan B, Beuerlein G, Campbell MA, Marquis D, Ondek B, Wooldridge JE, Smith BJ, Breitmeyer JB, Weiner GJ: Anti-CD20 monoclonal antibody with enhanced affinity for CD16 activates NK cells at lower concentrations and more effectively than rituximab. Blood. 2006 Oct 15;108(8):2648-54. Epub 2006 Jul 6. [PubMed:16825493 ]
  4. Hatjiharissi E, Xu L, Santos DD, Hunter ZR, Ciccarelli BT, Verselis S, Modica M, Cao Y, Manning RJ, Leleu X, Dimmock EA, Kortsaris A, Mitsiades C, Anderson KC, Fox EA, Treon SP: Increased natural killer cell expression of CD16, augmented binding and ADCC activity to rituximab among individuals expressing the Fc{gamma}RIIIa-158 V/V and V/F polymorphism. Blood. 2007 Oct 1;110(7):2561-4. Epub 2007 May 2. [PubMed:17475906 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type peptidase activity
Specific Function
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name
C1R
Uniprot ID
P00736
Uniprot Name
Complement C1r subcomponent
Molecular Weight
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QA
Uniprot ID
P02745
Uniprot Name
Complement C1q subcomponent subunit A
Molecular Weight
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
  3. Di Gaetano N, Cittera E, Nota R, Vecchi A, Grieco V, Scanziani E, Botto M, Introna M, Golay J: Complement activation determines the therapeutic activity of rituximab in vivo. J Immunol. 2003 Aug 1;171(3):1581-7. [PubMed:12874252 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QB
Uniprot ID
P02746
Uniprot Name
Complement C1q subcomponent subunit B
Molecular Weight
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QC
Uniprot ID
P02747
Uniprot Name
Complement C1q subcomponent subunit C
Molecular Weight
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as...
Gene Name
FCGR3A
Uniprot ID
P08637
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-A
Molecular Weight
29088.895 Da
References
  1. Niwa R, Hatanaka S, Shoji-Hosaka E, Sakurada M, Kobayashi Y, Uehara A, Yokoi H, Nakamura K, Shitara K: Enhancement of the antibody-dependent cellular cytotoxicity of low-fucose IgG1 Is independent of FcgammaRIIIa functional polymorphism. Clin Cancer Res. 2004 Sep 15;10(18 Pt 1):6248-55. [PubMed:15448014 ]
  2. Hatjiharissi E, Hansen M, Santos DD, Xu L, Leleu X, Dimmock EW, Ho AW, Hunter ZR, Branagan AR, Patterson CJ, Kortsaris A, Verselis S, Fox E, Treon SP: Genetic linkage of Fc gamma RIIa and Fc gamma RIIIa and implications for their use in predicting clinical responses to CD20-directed monoclonal antibody therapy. Clin Lymphoma Myeloma. 2007 Jan;7(4):286-90. [PubMed:17324336 ]
  3. Kim DH, Jung HD, Kim JG, Lee JJ, Yang DH, Park YH, Do YR, Shin HJ, Kim MK, Hyun MS, Sohn SK: FCGR3A gene polymorphisms may correlate with response to frontline R-CHOP therapy for diffuse large B-cell lymphoma. Blood. 2006 Oct 15;108(8):2720-5. Epub 2006 Apr 11. [PubMed:16609067 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type endopeptidase activity
Specific Function
C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activat...
Gene Name
C1S
Uniprot ID
P09871
Uniprot Name
Complement C1s subcomponent
Molecular Weight
76683.905 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Receptor signaling protein activity
Specific Function
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name
FCGR1A
Uniprot ID
P12314
Uniprot Name
High affinity immunoglobulin gamma Fc receptor I
Molecular Weight
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized ...
Gene Name
FCGR2A
Uniprot ID
P12318
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-a
Molecular Weight
35000.42 Da
References
  1. Hatjiharissi E, Hansen M, Santos DD, Xu L, Leleu X, Dimmock EW, Ho AW, Hunter ZR, Branagan AR, Patterson CJ, Kortsaris A, Verselis S, Fox E, Treon SP: Genetic linkage of Fc gamma RIIa and Fc gamma RIIIa and implications for their use in predicting clinical responses to CD20-directed monoclonal antibody therapy. Clin Lymphoma Myeloma. 2007 Jan;7(4):286-90. [PubMed:17324336 ]
  2. Kim DH, Jung HD, Kim JG, Lee JJ, Yang DH, Park YH, Do YR, Shin HJ, Kim MK, Hyun MS, Sohn SK: FCGR3A gene polymorphisms may correlate with response to frontline R-CHOP therapy for diffuse large B-cell lymphoma. Blood. 2006 Oct 15;108(8):2720-5. Epub 2006 Apr 11. [PubMed:16609067 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complex...
Gene Name
FCGR2B
Uniprot ID
P31994
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-b
Molecular Weight
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Transmembrane signaling receptor activity
Specific Function
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulat...
Gene Name
FCGR2C
Uniprot ID
P31995
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-c
Molecular Weight
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antibody
General Function
Mhc class ii protein complex binding
Specific Function
This protein may be involved in the regulation of B-cell activation and proliferation.
Gene Name
MS4A1
Uniprot ID
P11836
Uniprot Name
B-lymphocyte antigen CD20
Molecular Weight
33076.99 Da
References
  1. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
  2. van Meerten T, Hagenbeek A: CD20-targeted therapy: the next generation of antibodies. Semin Hematol. 2010 Apr;47(2):199-210. doi: 10.1053/j.seminhematol.2010.01.007. [PubMed:20350667 ]
  3. Jaglowski SM, Byrd JC: Rituximab in chronic lymphocytic leukemia. Semin Hematol. 2010 Apr;47(2):156-69. doi: 10.1053/j.seminhematol.2010.01.005. [PubMed:20350663 ]

Drug created on June 13, 2005 07:24 / Updated on September 01, 2017 15:53