Digoxin Immune Fab (Ovine)

Identification

Name
Digoxin Immune Fab (Ovine)
Accession Number
DB00076  (BTD00046, BTD00027, BIOD00046, BIOD00027)
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Digoxin Immune Fab is a sheep antibody (26-10) FAB fragment from sheep immunized with the digoxin derivative Digoxindicarboxymethylamine. It is used as an antidote for overdose of digoxin.

Protein structure
Db00076
Protein chemical formula
C2085H3223N553O672S16
Protein average weight
47301.7 Da
Sequences
>26-10 Heavy chain (murine)
EVQLQQSGPELVKPGASVRMSCKSSGYIFTDFYMNWVRQSHGKSLDYIGYISPYSGVTGY
NQKFKGKATLTVDKSSSTAYMELRSLTSEDSAVYYCAGSSGNKWAMDYWGHGASVTVSSA
KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
>26-10 Light chain (murine)
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLNWYLQKAGQSPKLLIYKVSNRF
SGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCSQTTHVPPTFGGGTKLEIKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Download FASTA Format
Synonyms
  • Digitalis antitoxin
  • Digoxin Immune Fab, Ovine
  • Digoxin-specific Antibody Fragments
  • Ovine digoxin immune fab
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
DigibindPowder, for solution38 mgIntravenousGlaxosmithkline Inc1995-12-312013-02-06Canada
DigiFabPowder, for solution40 mgIntravenousBtg International Inc2011-11-04Not applicableCanada
DigiFabInjection, powder, for solution40 mg/1IntravenousBtg International Inc2001-08-31Not applicableUs
DigiFabInjection, powder, lyophilized, for solution38 mg/1IntravenousSAVAGE LABORATORIES, A division of Nycomed US Inc.2001-08-31Not applicableUs
Categories
UNII
YB12NQZ1YN
CAS number
Not Available

Pharmacology

Indication

For treatment of digitoxin overdose or digitalis glycoside toxicity.

Structured Indications
Pharmacodynamics

DigiFab binds molecules of digoxin, making them unavailable for binding at their site of action on cells in the body. The Fab fragment-digoxin complex accumulates in the blood, from which it is excreted by the kidney. The net effect is to shift the equilibrium away from binding of digoxin to its receptors in the body, thereby reversing its effects.

Mechanism of action

Binds excess digoxin or digitoxin molecules circulating in the blood.

TargetActionsOrganism
ADigoxin
other/unknown
Human
Absorption
Not Available
Volume of distribution
  • 0.3 L/kg [DigiFab]
  • 0.4 L/kg [Digibind]
Protein binding
Not Available
Metabolism
Not Available
Route of elimination

Cumulative urinary excretion of digoxin was comparable for both products and exceeded 40% of the administered dose by 24 hours.

Half life

15-20 hrs

Clearance
Not Available
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
10-hydroxycamptothecinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of 10-hydroxycamptothecin.Investigational
2-(4-Chlorophenyl)-5-QuinoxalinecarboxamideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of 2-(4-Chlorophenyl)-5-Quinoxalinecarboxamide.Experimental
2-chloroethyl-3-sarcosinamide-1-nitrosoureaDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of 2-chloroethyl-3-sarcosinamide-1-nitrosourea.Investigational
2-MethoxyestradiolDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of 2-Methoxyestradiol.Investigational
3-MethoxybenzamideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of 3-Methoxybenzamide.Experimental
3,3'-diindolylmethaneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of 3,3'-diindolylmethane.Investigational
3,4-Dihydroxybenzoic AcidDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of 3,4-Dihydroxybenzoic Acid.Experimental
6-O-benzylguanineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of 6-O-benzylguanine.Investigational
7-HydroxystaurosporineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of 7-Hydroxystaurosporine.Experimental, Investigational
8-azaguanineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of 8-azaguanine.Experimental
9-aminocamptothecinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of 9-aminocamptothecin.Investigational
AbirateroneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Abiraterone.Approved
AcebutololAcebutolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved
AclarubicinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Aclarubicin.Investigational
Acridine CarboxamideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Acridine Carboxamide.Investigational
ActeosideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Acteoside.Investigational
AfatinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Afatinib.Approved
AfimoxifeneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Afimoxifene.Investigational
AfliberceptDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Aflibercept.Approved
AlanosineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of L-alanosine.Investigational
AlatrofloxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Alatrofloxacin.Withdrawn
AlbendazoleDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Albendazole.Approved, Vet Approved
AlcuroniumAlcuronium may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Experimental
AldesleukinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Aldesleukin.Approved
AlectinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Alectinib.Approved
AlemtuzumabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Alemtuzumab.Approved, Investigational
AlitretinoinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Alitretinoin.Approved, Investigational
AlprenololAlprenolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved, Withdrawn
AltretamineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Altretamine.Approved
AlvocidibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Alvocidib.Experimental, Investigational
AmikacinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Amikacin.Approved, Vet Approved
AmilorideThe therapeutic efficacy of Digoxin Immune Fab (Ovine) can be decreased when used in combination with Amiloride.Approved
AminoglutethimideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Aminoglutethimide.Approved, Investigational
Aminolevulinic acidDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Aminolevulinic acid.Approved
AmiodaroneThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Amiodarone.Approved, Investigational
AmodiaquineThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Amodiaquine.Approved, Investigational
AmonafideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Amonafide.Investigational
Amphotericin BThe risk or severity of adverse effects can be increased when Amphotericin B is combined with Digoxin Immune Fab (Ovine).Approved, Investigational
AmrubicinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Amrubicin.Approved, Investigational
AmsacrineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Amsacrine.Approved
AnagrelideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Anagrelide.Approved
AnastrozoleDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Anastrozole.Approved, Investigational
AnecortaveDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Anecortave.Investigational
annamycinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of annamycin.Investigational
AP 12009Digoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of AP 12009.Investigational
AP24534Digoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of AP24534.Investigational
ApaziquoneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Apaziquone.Investigational
ApramycinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Apramycin.Experimental, Vet Approved
ArbekacinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Arbekacin.Approved, Investigational
Arotinoid acidDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Arotinoid acid.Experimental
ArotinololArotinolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved, Investigational
Arsanilic acidDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Arsanilic acid.Experimental, Vet Approved
Arsenic trioxideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Arsenic trioxide.Approved, Investigational
AsparaginaseDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Asparaginase.Approved
AtenololAtenolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved
AtezolizumabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Atezolizumab.Approved
AtracuriumAtracurium may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Experimental, Investigational
Atracurium besylateAtracurium besylate may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved
AxitinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Axitinib.Approved, Investigational
AzacitidineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Azacitidine.Approved, Investigational
AzathioprineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Azathioprine.Approved
Azelaic AcidDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Azelaic Acid.Approved
AzithromycinThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Azithromycin.Approved
BalsalazideThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Balsalazide.Approved, Investigational
BatimastatDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Batimastat.Experimental
BefunololBefunolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Experimental
BekanamycinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Bekanamycin.Experimental
BelinostatDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Belinostat.Approved, Investigational
BelotecanDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Belotecan.Investigational
BendamustineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Bendamustine.Approved, Investigational
BendroflumethiazideThe risk or severity of adverse effects can be increased when Bendroflumethiazide is combined with Digoxin Immune Fab (Ovine).Approved
BesifloxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Besifloxacin.Approved
BetaxololBetaxolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved
BevacizumabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Bevacizumab.Approved, Investigational
BevantololBevantolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved
BexaroteneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Bexarotene.Approved, Investigational
BicalutamideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Bicalutamide.Approved
BinetrakinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Binetrakin.Investigational
BisoprololBisoprolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved
BizelesinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Bizelesin.Investigational
BleomycinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Bleomycin.Approved
BlinatumomabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Blinatumomab.Approved
BopindololBopindolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved
BortezomibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Bortezomib.Approved, Investigational
BosutinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Bosutinib.Approved
Brentuximab vedotinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Brentuximab vedotin.Approved
BroxuridineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Broxuridine.Investigational
Bryostatin 1Digoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Bryostatin 1.Investigational
BSI-201Digoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of BSI-201.Investigational
BucindololBucindolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Investigational
BufuralolBufuralol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Experimental, Investigational
BumetanideThe risk or severity of adverse effects can be increased when Bumetanide is combined with Digoxin Immune Fab (Ovine).Approved
BupranololBupranolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved
BuserelinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Buserelin.Approved
BusulfanDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Busulfan.Approved, Investigational
Buthionine SulfoximineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Buthionine Sulfoximine.Investigational
CabazitaxelDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Cabazitaxel.Approved
CabergolineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Cabergoline.Approved
CabozantinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Cabozantinib.Approved
CalcidiolCalcidiol may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved, Nutraceutical
CalcipotriolDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Calcipotriol.Approved
Calcium AcetateCalcium Acetate may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved
Calcium CarbonateCalcium Carbonate may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved
Calcium ChlorideCalcium Chloride may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved
Calcium CitrateCalcium Citrate may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved
Calcium glubionateCalcium glubionate may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved
Calcium GluceptateCalcium Gluceptate may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved
Calcium gluconateCalcium gluconate may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved, Vet Approved
Calcium lactateCalcium lactate may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved, Experimental, Investigational, Vet Approved
Calcium lactate gluconateCalcium lactate gluconate may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Experimental
Calcium laevulateCalcium laevulate may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Experimental
Calcium pangamateCalcium pangamate may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Experimental
Calcium PhosphateCalcium Phosphate may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved
CamptothecinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Camptothecin.Experimental
CanertinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Canertinib.Investigational
CapecitabineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Capecitabine.Approved, Investigational
CarbimazoleThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Carbimazole.Approved, Investigational
CarbomycinThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Carbomycin.Vet Approved
CarboplatinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Carboplatin.Approved
CarboquoneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Carboquone.Experimental
CarboxyamidotriazoleDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Carboxyamidotriazole.Investigational
CarfilzomibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Carfilzomib.Approved
CarmofurDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Carmofur.Withdrawn
CarmustineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Carmustine.Approved
CarteololCarteolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved
CarvedilolCarvedilol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved, Investigational
CaseinCasein may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved
CatumaxomabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Catumaxomab.Approved, Investigational
CediranibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Cediranib.Investigational
CeliprololCeliprolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved, Investigational
CeritinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Ceritinib.Approved
CetuximabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Cetuximab.Approved
ChlorambucilDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Chlorambucil.Approved
ChloroquineThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Chloroquine.Approved, Vet Approved
ChlorothiazideThe risk or severity of adverse effects can be increased when Chlorothiazide is combined with Digoxin Immune Fab (Ovine).Approved, Vet Approved
ChlorotrianiseneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Chlorotrianisene.Investigational, Withdrawn
ChlorthalidoneThe risk or severity of adverse effects can be increased when Chlorthalidone is combined with Digoxin Immune Fab (Ovine).Approved
CholesterolDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Cholesterol.Experimental, Investigational
CholestyramineCholestyramine can cause a decrease in the absorption of Digoxin Immune Fab (Ovine) resulting in a reduced serum concentration and potentially a decrease in efficacy.Approved
CinoxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Cinoxacin.Approved, Investigational, Withdrawn
CiprofloxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Ciprofloxacin.Approved, Investigational
CisatracuriumCisatracurium may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved, Experimental
Cisatracurium besylateCisatracurium besylate may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved
CisplatinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Cisplatin.Approved
CladribineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Cladribine.Approved, Investigational
ClarithromycinThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Clarithromycin.Approved
ClofarabineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Clofarabine.Approved, Investigational
ClonidineClonidine may increase the atrioventricular blocking (AV block) activities of Digoxin Immune Fab (Ovine).Approved
CloranololCloranolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Experimental
CobimetinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Cobimetinib.Approved
ColchicineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Colchicine.Approved
ColesevelamColesevelam can cause a decrease in the absorption of Digoxin Immune Fab (Ovine) resulting in a reduced serum concentration and potentially a decrease in efficacy.Approved
ColestipolColestipol can cause a decrease in the absorption of Digoxin Immune Fab (Ovine) resulting in a reduced serum concentration and potentially a decrease in efficacy.Approved
CombretastatinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Combretastatin.Investigational
CordycepinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Cordycepin.Investigational
Coumermycin A1Digoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Coumermycin A1.Experimental
CrenolanibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Crenolanib.Investigational
CrizotinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Crizotinib.Approved
CurcuminDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Curcumin.Investigational
CyclopenthiazideThe risk or severity of adverse effects can be increased when Cyclopenthiazide is combined with Digoxin Immune Fab (Ovine).Experimental
CyclophosphamideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Cyclophosphamide.Approved, Investigational
Cyproterone acetateDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Cyproterone acetate.Approved, Investigational
CytarabineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Cytarabine.Approved, Investigational
DabrafenibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Dabrafenib.Approved
DacarbazineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Dacarbazine.Approved, Investigational
DactinomycinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Dactinomycin.Approved
DaratumumabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Daratumumab.Approved
DasatinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Dasatinib.Approved, Investigational
DaunorubicinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Daunorubicin.Approved
DecamethoniumDecamethonium may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved
DecitabineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Decitabine.Approved, Investigational
DegarelixDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Degarelix.Approved
DemecolcineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Demecolcine.Experimental
Denileukin diftitoxDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Denileukin diftitox.Approved, Investigational
DeoxyspergualinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Deoxyspergualin.Investigational
DexamethasoneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Dexamethasone.Approved, Investigational, Vet Approved
DexrazoxaneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Dexrazoxane.Approved, Withdrawn
DianhydrogalactitolDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Dianhydrogalactitol.Investigational
DibekacinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Dibekacin.Experimental
DidoxDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Didox.Investigational
DienogestDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Dienogest.Approved
diethylnorspermineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of diethylnorspermine.Investigational
DiethylstilbestrolDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Diethylstilbestrol.Approved, Investigational
DihydrostreptomycinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Dihydrostreptomycin.Investigational, Vet Approved
DihydrotachysterolDihydrotachysterol may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved
DiltiazemDiltiazem may increase the atrioventricular blocking (AV block) activities of Digoxin Immune Fab (Ovine).Approved
DinutuximabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Dinutuximab.Approved
DocetaxelDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Docetaxel.Approved, Investigational
Dolastatin 10Digoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Dolastatin 10.Investigational
Domoic AcidDomoic Acid may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Experimental
Doxacurium chlorideDoxacurium chloride may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved
DoxercalciferolDoxercalciferol may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved
DoxifluridineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Doxifluridine.Investigational
DoxorubicinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Doxorubicin.Approved, Investigational
DuligotuzumabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Duligotuzumab.Investigational
EcabetDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Ecabet.Approved, Investigational
EdrecolomabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Edrecolomab.Experimental, Investigational
EdrophoniumEdrophonium may increase the atrioventricular blocking (AV block) activities of Digoxin Immune Fab (Ovine).Approved
EfaproxiralDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Efaproxiral.Investigational
EfatutazoneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Efatutazone.Investigational
EflornithineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Eflornithine.Approved, Withdrawn
EG009Digoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of EG009.Investigational
ElotuzumabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Elotuzumab.Approved
ElsamitrucinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Elsamitrucin.Investigational
EndostatinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Endostatin.Investigational
EnoxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Enoxacin.Approved, Investigational
EnrofloxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Enrofloxacin.Vet Approved
EntinostatDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Entinostat.Investigational
EnzalutamideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Enzalutamide.Approved
EpanololEpanolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Experimental
Epigallocatechin GallateDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Epigallocatechin Gallate.Investigational
EpirubicinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Epirubicin.Approved
EplerenoneThe therapeutic efficacy of Digoxin Immune Fab (Ovine) can be decreased when used in combination with Eplerenone.Approved
EpofolateDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Epofolate.Investigational
ErgocalciferolErgocalciferol may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved, Nutraceutical
EribulinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Eribulin.Approved, Investigational
ErlotinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Erlotinib.Approved, Investigational
ErythromycinThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Erythromycin.Approved, Vet Approved
EsmololEsmolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved
EstramustineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Estramustine.Approved
Etacrynic acidThe risk or severity of adverse effects can be increased when Etacrynic acid is combined with Digoxin Immune Fab (Ovine).Approved
EtanidazoleDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Etanidazole.Investigational
Ethiodized oilDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Ethiodized oil.Approved
Ethyl carbamateDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Ethyl carbamate.Withdrawn
EtoglucidDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Etoglucid.Experimental
EtoposideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Etoposide.Approved
EverolimusDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Everolimus.Approved
ExatecanDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Exatecan.Investigational
ExemestaneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Exemestane.Approved, Investigational
exisulindDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of exisulind.Investigational
FenretinideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Fenretinide.Investigational
FiacitabineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Fiacitabine.Investigational
FleroxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Fleroxacin.Approved
FloxuridineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Floxuridine.Approved
FludarabineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Fludarabine.Approved
FlumequineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Flumequine.Withdrawn
FluorouracilDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Fluorouracil.Approved
FlutamideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Flutamide.Approved
FormestaneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Formestane.Approved, Investigational, Withdrawn
FormycinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Formycin.Experimental
FosbretabulinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Fosbretabulin.Investigational
FotemustineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Fotemustine.Experimental, Investigational
FramycetinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Framycetin.Approved
FulvestrantDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Fulvestrant.Approved, Investigational
FumagillinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Fumagillin.Experimental
FurosemideThe risk or severity of adverse effects can be increased when Furosemide is combined with Digoxin Immune Fab (Ovine).Approved, Vet Approved
GallamineGallamine may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Experimental
Gallamine TriethiodideGallamine Triethiodide may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved
Gallium nitrateDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Gallium nitrate.Approved, Investigational
GarenoxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Garenoxacin.Investigational
GatifloxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Gatifloxacin.Approved, Investigational
GefitinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Gefitinib.Approved, Investigational
GeldanamycinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Geldanamycin.Experimental, Investigational
GemcitabineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Gemcitabine.Approved
GemifloxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Gemifloxacin.Approved, Investigational
Gemtuzumab ozogamicinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Gemtuzumab ozogamicin.Approved
GeneticinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Geneticin.Experimental
GenisteinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Genistein.Investigational
GentamicinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Gentamicin.Approved, Vet Approved
GENTAMICIN C1AThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with GENTAMICIN C1A.Experimental
Ginsenoside CDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Ginsenoside C.Nutraceutical
GoserelinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Goserelin.Approved
GPX-150The serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with GPX-150.Investigational
GrepafloxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Grepafloxacin.Investigational, Withdrawn
GS 0573Digoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of GS 0573.Investigational
GusperimusDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Gusperimus.Investigational
HadacidinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Hadacidin.Experimental
HalofuginoneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Halofuginone.Investigational, Vet Approved
HexestrolDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Hexestrol.Withdrawn
HydrochlorothiazideThe risk or severity of adverse effects can be increased when Hydrochlorothiazide is combined with Digoxin Immune Fab (Ovine).Approved, Vet Approved
HydroflumethiazideThe risk or severity of adverse effects can be increased when Hydroflumethiazide is combined with Digoxin Immune Fab (Ovine).Approved, Investigational
HydroxychloroquineThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Hydroxychloroquine.Approved
Hydroxyprogesterone caproateDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Hydroxyprogesterone caproate.Approved
HydroxyureaDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Hydroxyurea.Approved
Hygromycin BThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Hygromycin B.Vet Approved
HypericinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Hypericin.Investigational
IbrutinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Ibrutinib.Approved
IdarubicinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Idarubicin.Approved
IdelalisibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Idelalisib.Approved
IfosfamideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Ifosfamide.Approved
ImatinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Imatinib.Approved
ImiquimodDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Imiquimod.Approved, Investigational
IndapamideThe risk or severity of adverse effects can be increased when Indapamide is combined with Digoxin Immune Fab (Ovine).Approved
IndenololIndenolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Withdrawn
IndirubinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Indirubin.Investigational
Indole-3-carbinolDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Indole-3-carbinol.Investigational
InfigratinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Infigratinib.Investigational
IniparibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Iniparib.Experimental, Investigational
INNO-206The serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with INNO-206.Investigational
Interferon Alfa-2b, RecombinantDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Interferon Alfa-2b, Recombinant.Approved
Interferon beta-1aDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Interferon beta-1a.Approved, Investigational
IobenguaneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Iobenguane.Approved, Investigational
IpilimumabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Ipilimumab.Approved
IrinotecanDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Irinotecan.Approved, Investigational
IrofulvenDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Irofulven.Investigational
IrsogladineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Irsogladine.Investigational
IsepamicinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Isepamicin.Experimental
IsosorbideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Isosorbide.Approved, Investigational
ItraconazoleThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Itraconazole.Approved, Investigational
IxabepiloneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Ixabepilone.Approved, Investigational
IxazomibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Ixazomib.Approved
JosamycinThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Josamycin.Approved, Investigational
KanamycinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Kanamycin.Approved, Investigational, Vet Approved
KaolinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Kaolin.Approved
KitasamycinThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Kitasamycin.Experimental
KOS-1584Digoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of KOS-1584.Investigational
KRN-7000Digoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of KRN-7000.Investigational
LabetalolLabetalol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved
LandiololLandiolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Investigational
LanreotideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Lanreotide.Approved
LapatinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Lapatinib.Approved, Investigational
LCL-161Digoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of LCL-161.Investigational
LeflunomideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Leflunomide.Approved, Investigational
LenalidomideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Lenalidomide.Approved
LentinanDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Lentinan.Experimental, Investigational
LenvatinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Lenvatinib.Approved
LetrozoleDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Letrozole.Approved, Investigational
LeuprolideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Leuprolide.Approved, Investigational
LevobunololLevobunolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved
LevofloxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Levofloxacin.Approved, Investigational
LiarozoleDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Liarozole.Investigational
LicoriceThe risk or severity of adverse effects can be increased when Licorice is combined with Digoxin Immune Fab (Ovine).Approved
LomefloxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Lomefloxacin.Approved, Investigational
LometrexolDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Lometrexol.Investigational
LomustineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Lomustine.Approved
LonidamineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Lonidamine.Investigational
LurtotecanDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Lurtotecan.Investigational
LycopeneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Lycopene.Approved
MafosfamideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Mafosfamide.Investigational
MannosulfanDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Mannosulfan.Experimental
MasitinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Masitinib.Investigational, Vet Approved
MasoprocolDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Masoprocol.Approved, Investigational
MaxacalcitolDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Maxacalcitol.Approved, Investigational
MebendazoleDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Mebendazole.Approved, Vet Approved
MechlorethamineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Mechlorethamine.Approved
MedrogestoneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Medrogestone.Approved
Medroxyprogesterone acetateDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Medroxyprogesterone acetate.Approved, Investigational
Megestrol acetateDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Megestrol acetate.Approved, Vet Approved
MelphalanDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Melphalan.Approved
MepindololMepindolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Experimental
MequinolDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Mequinol.Approved
MercaptopurineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Mercaptopurine.Approved
MerestinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Merestinib.Investigational
MesalazineThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Mesalazine.Approved
MethimazoleThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Methimazole.Approved
MethotrexateDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Methotrexate.Approved
MethyclothiazideThe risk or severity of adverse effects can be increased when Methyclothiazide is combined with Digoxin Immune Fab (Ovine).Approved
Methyl aminolevulinateDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Methyl aminolevulinate.Approved
MethylprednisoloneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Methylprednisolone.Approved, Vet Approved
MethylselenocysteineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Methylselenocysteine.Investigational
MethyltestosteroneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Methyltestosterone.Approved
MethylthiouracilThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Methylthiouracil.Experimental
MetipranololMetipranolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved
MetocurineMetocurine may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved
Metocurine IodideMetocurine Iodide may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Withdrawn
MetolazoneThe risk or severity of adverse effects can be increased when Metolazone is combined with Digoxin Immune Fab (Ovine).Approved
MetoprineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Metoprine.Experimental
MetoprololMetoprolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved, Investigational
MetrizamideThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Metrizamide.Approved
MicronomicinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Micronomicin.Experimental
MidodrineDigoxin Immune Fab (Ovine) may increase the bradycardic activities of Midodrine.Approved
MidostaurinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Midostaurin.Approved
MiltefosineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Miltefosine.Approved
MisonidazoleDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Misonidazole.Investigational
MitobronitolDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Mitobronitol.Experimental
MitoguazoneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Mitoguazone.Investigational
MitolactolDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Mitolactol.Investigational
MitomycinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Mitomycin.Approved
MitotaneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Mitotane.Approved
MitoxantroneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Mitoxantrone.Approved, Investigational
MivacuriumMivacurium may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved
MizoribineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Mizoribine.Investigational
MLN576Digoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of MLN576.Investigational
MolgramostimDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Molgramostim.Investigational
motexafin gadoliniumDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of motexafin gadolinium.Investigational
MoxifloxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Moxifloxacin.Approved, Investigational
Mycophenolate mofetilDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Mycophenolate mofetil.Approved, Investigational
Mycophenolic acidDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Mycophenolic acid.Approved
NadifloxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Nadifloxacin.Investigational
NadololNadolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved
Nalidixic AcidDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Nalidixic Acid.Approved, Investigational
NamitecanDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Namitecan.Investigational
NavitoclaxDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Navitoclax.Investigational
NeamineThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Neamine.Experimental
NebivololNebivolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved, Investigational
NebularineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Nebularine.Experimental
NecitumumabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Necitumumab.Approved
NedaplatinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Nedaplatin.Approved, Investigational
NelarabineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Nelarabine.Approved, Investigational
NeomycinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Neomycin.Approved, Vet Approved
NeosaxitoxinNeosaxitoxin may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Investigational
NetilmicinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Netilmicin.Approved, Investigational
NiguldipineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Niguldipine.Experimental
NilotinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Nilotinib.Approved, Investigational
NilutamideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Nilutamide.Approved
NimustineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Nimustine.Investigational
NintedanibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Nintedanib.Approved
NiraparibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Niraparib.Approved, Investigational
NivolumabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Nivolumab.Approved
nocodazoleDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of nocodazole.Experimental
NolatrexedDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Nolatrexed.Investigational
NorfloxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Norfloxacin.Approved
ObinutuzumabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Obinutuzumab.Approved
OblimersenDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Oblimersen.Experimental, Investigational
OBP-801Digoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of OBP-801.Investigational
OctreotideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Octreotide.Approved, Investigational
OfatumumabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Ofatumumab.Approved
OfloxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Ofloxacin.Approved
OglufanideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Oglufanide.Investigational
OlaparibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Olaparib.Approved
OleandomycinThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Oleandomycin.Vet Approved
OlsalazineThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Olsalazine.Approved
OltiprazDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Oltipraz.Investigational
Omacetaxine mepesuccinateDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Omacetaxine mepesuccinate.Approved
OnapristoneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Onapristone.Investigational
OprelvekinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Oprelvekin.Approved, Investigational
OsimertinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Osimertinib.Approved
OxaliplatinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Oxaliplatin.Approved, Investigational
Oxolinic acidDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Oxolinic acid.Experimental
OxprenololOxprenolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved
PaclitaxelDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Paclitaxel.Approved, Vet Approved
Paclitaxel poliglumexDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Paclitaxel poliglumex.Experimental, Investigational
PalbociclibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Palbociclib.Approved
PalifosfamideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Palifosfamide.Investigational
PamidronateDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Pamidronate.Approved
PancuroniumPancuronium may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved
PanitumumabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Panitumumab.Approved, Investigational
PanobinostatDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Panobinostat.Approved, Investigational
Parathyroid hormoneThe risk or severity of adverse effects can be increased when Parathyroid hormone is combined with Digoxin Immune Fab (Ovine).Approved, Investigational
ParicalcitolParicalcitol may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved, Investigational
ParomomycinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Paromomycin.Approved, Investigational
PatupiloneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Patupilone.Experimental, Investigational
PazopanibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Pazopanib.Approved
PazufloxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Pazufloxacin.Investigational
PefloxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Pefloxacin.Approved
PegaspargaseDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Pegaspargase.Approved, Investigational
PembrolizumabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Pembrolizumab.Approved
PemetrexedDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Pemetrexed.Approved, Investigational
PenbutololPenbutolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved, Investigational
PenclomedineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Penclomedine.Investigational
PentostatinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Pentostatin.Approved, Investigational
PertuzumabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Pertuzumab.Approved
Phenethyl IsothiocyanateDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Phenethyl Isothiocyanate.Investigational
Phenylacetic acidDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Phenylacetic acid.Approved
Phenylbutyric acidDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Phenylbutyric acid.Approved, Investigational
PindololPindolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved
PinometostatDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Pinometostat.Investigational
PipecuroniumPipecuronium may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved
PipobromanDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Pipobroman.Approved
PirarubicinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Pirarubicin.Investigational
PiretanideThe risk or severity of adverse effects can be increased when Piretanide is combined with Digoxin Immune Fab (Ovine).Experimental
PirfenidoneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Pirfenidone.Approved, Investigational
PirlindoleDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Pirlindole.Approved
PixantroneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Pixantrone.Approved, Investigational
Platelet Activating FactorPlatelet Activating Factor may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Experimental
PlazomicinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Plazomicin.Investigational
PlevitrexedDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Plevitrexed.Investigational
PlicamycinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Plicamycin.Approved, Investigational, Withdrawn
PodofiloxDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Podofilox.Approved
PodophyllinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Podophyllin.Approved
PolythiazideThe risk or severity of adverse effects can be increased when Polythiazide is combined with Digoxin Immune Fab (Ovine).Approved
PomalidomideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Pomalidomide.Approved
PonatinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Ponatinib.Approved
Porfimer sodiumDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Porfimer sodium.Approved, Investigational
porfiromycinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of porfiromycin.Investigational
Potassium IodideThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Potassium Iodide.Approved
PractololPractolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved
PralatrexateDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Pralatrexate.Approved
PrednimustineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Prednimustine.Investigational
PrednisoloneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Prednisolone.Approved, Vet Approved
PrednisoneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Prednisone.Approved, Vet Approved
PrimaquineThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Primaquine.Approved
ProcarbazineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Procarbazine.Approved
PropafenoneThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Propafenone.Approved
PropranololPropranolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved, Investigational
PropylthiouracilThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Propylthiouracil.Approved
PrulifloxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Prulifloxacin.Investigational
PuromycinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Puromycin.Experimental
PyrantelPyrantel may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved, Vet Approved
PyrazoloacridineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Pyrazoloacridine.Investigational
QuinacrineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Quinacrine.Approved, Investigational
QuinethazoneThe risk or severity of adverse effects can be increased when Quinethazone is combined with Digoxin Immune Fab (Ovine).Approved
QuinidineThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Quinidine.Approved
RabusertibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Rabusertib.Investigational
Radium Ra 223 DichlorideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Radium Ra 223 Dichloride.Approved, Investigational
RaltitrexedDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Raltitrexed.Approved, Investigational
RamucirumabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Ramucirumab.Approved, Investigational
RanibizumabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Ranibizumab.Approved
RanimustineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Ranimustine.Experimental
RanpirnaseDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Ranpirnase.Investigational
RapacuroniumRapacuronium may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Withdrawn
RegorafenibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Regorafenib.Approved
ReserpineThe risk or severity of adverse effects can be increased when Reserpine is combined with Digoxin Immune Fab (Ovine).Approved, Investigational
ResveratrolDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Resveratrol.Approved, Experimental, Investigational
Rhodamine 6GDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Rhodamine 6G.Experimental
RibostamycinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Ribostamycin.Approved, Investigational
RidaforolimusDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Ridaforolimus.Investigational
RituximabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Rituximab.Approved
RocuroniumRocuronium may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved
RomidepsinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Romidepsin.Approved, Investigational
RoquinimexDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Roquinimex.Investigational
RubitecanDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Rubitecan.Investigational
RucaparibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Rucaparib.Approved, Investigational
RufloxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Rufloxacin.Experimental
RuxolitinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Ruxolitinib.Approved
SabarubicinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Sabarubicin.Investigational
SalirasibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Salirasib.Investigational
SaracatinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Saracatinib.Investigational
SatraplatinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Satraplatin.Investigational
SeliciclibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Seliciclib.Investigational
SemaxanibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Semaxanib.Investigational
SemustineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Semustine.Experimental, Investigational
SeocalcitolDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Seocalcitol.Experimental, Investigational
SiltuximabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Siltuximab.Approved
SirolimusDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Sirolimus.Approved, Investigational
SisomicinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Sisomicin.Investigational
SitafloxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Sitafloxacin.Experimental, Investigational
SizofiranDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Sizofiran.Investigational
SoblidotinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Soblidotin.Investigational
SolithromycinThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Solithromycin.Investigational
SonidegibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Sonidegib.Approved, Investigational
SorafenibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Sorafenib.Approved, Investigational
SotalolSotalol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved
SP1049CThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with SP1049C.Investigational
SparfloxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Sparfloxacin.Approved, Investigational
Sparfosic acidDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Sparfosic acid.Experimental
SparsomycinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Sparsomycin.Experimental
SpectinomycinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Spectinomycin.Approved, Investigational, Vet Approved
SpiramycinThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Spiramycin.Approved
SpironolactoneThe therapeutic efficacy of Digoxin Immune Fab (Ovine) can be decreased when used in combination with Spironolactone.Approved
squalamineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of squalamine.Investigational
SRT501Digoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of SRT501.Investigational
StreptomycinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Streptomycin.Approved, Vet Approved
StreptozocinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Streptozocin.Approved
SuccinylcholineSuccinylcholine may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved
SulforaphaneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Sulforaphane.Investigational
SulindacDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Sulindac.Approved
SulpirideThe risk or severity of adverse effects can be increased when Sulpiride is combined with Digoxin Immune Fab (Ovine).Approved, Investigational
SunitinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Sunitinib.Approved, Investigational
SuraminDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Suramin.Approved, Investigational
TalaporfinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Talaporfin.Investigational
TalazoparibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Talazoparib.Investigational
TalinololTalinolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Investigational
TamoxifenDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Tamoxifen.Approved
TaselisibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Taselisib.Investigational
TaurolidineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Taurolidine.Investigational
TegafurDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Tegafur.Approved
TelithromycinThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Telithromycin.Approved
TelmisartanThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Telmisartan.Approved, Investigational
TemafloxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Temafloxacin.Withdrawn
TemoporfinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Temoporfin.Approved, Investigational
TemozolomideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Temozolomide.Approved, Investigational
TemsirolimusDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Temsirolimus.Approved
TeniposideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Teniposide.Approved
TertatololTertatolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Experimental
TestolactoneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Testolactone.Approved, Investigational
TezacitabineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Tezacitabine.Investigational
ThalidomideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Thalidomide.Approved, Investigational, Withdrawn
ThiotepaDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Thiotepa.Approved
ThymalfasinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Thymalfasin.Approved, Investigational
TiazofurineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Tiazofurine.Experimental
TiboloneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Tibolone.Approved, Investigational
TimololTimolol may increase the bradycardic activities of Digoxin Immune Fab (Ovine).Approved
TioguanineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Tioguanine.Approved
Tiomolibdate ionDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Tiomolibdate ion.Investigational
TipifarnibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Tipifarnib.Investigational
TirapazamineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Tirapazamine.Investigational
TivozanibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Tivozanib.Investigational
TobramycinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Tobramycin.Approved, Investigational
TolevamerThe risk or severity of adverse effects can be increased when Tolevamer is combined with Digoxin Immune Fab (Ovine).Approved
TopotecanDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Topotecan.Approved, Investigational
TorasemideThe risk or severity of adverse effects can be increased when Torasemide is combined with Digoxin Immune Fab (Ovine).Approved
ToremifeneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Toremifene.Approved, Investigational
TositumomabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Tositumomab.Approved, Investigational
ToyocamycinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Toyocamycin.Experimental
TrabectedinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Trabectedin.Approved, Investigational
TrametinibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Trametinib.Approved
TrastuzumabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Trastuzumab.Approved, Investigational
Trastuzumab emtansineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Trastuzumab emtansine.Approved
TrebananibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Trebananib.Investigational
TremelimumabDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Tremelimumab.Investigational
TreosulfanDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Treosulfan.Investigational
TretazicarDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Tretazicar.Investigational
TretinoinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Tretinoin.Approved, Investigational, Nutraceutical
TriamtereneThe therapeutic efficacy of Digoxin Immune Fab (Ovine) can be decreased when used in combination with Triamterene.Approved
TriaziquoneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Triaziquone.Experimental
TrichlormethiazideThe risk or severity of adverse effects can be increased when Trichlormethiazide is combined with Digoxin Immune Fab (Ovine).Approved, Vet Approved
TrifluridineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Trifluridine.Approved
TrilostaneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Trilostane.Approved, Investigational, Vet Approved, Withdrawn
TrimetrexateDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Trimetrexate.Approved, Investigational
TriptolideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Triptolide.Investigational
TriptorelinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Triptorelin.Approved, Vet Approved
TrofosfamideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Trofosfamide.Investigational
TrovafloxacinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Trovafloxacin.Approved, Investigational, Withdrawn
TroxacitabineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Troxacitabine.Investigational
TubercidinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Tubercidin.Experimental
TubocurarineTubocurarine may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved
TylosinThe serum concentration of Digoxin Immune Fab (Ovine) can be increased when it is combined with Tylosin.Vet Approved
UbenimexDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Ubenimex.Experimental, Investigational
Uracil mustardDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Uracil mustard.Approved
VadimezanDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Vadimezan.Investigational
ValrubicinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Valrubicin.Approved
VandetanibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Vandetanib.Approved
VapreotideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Vapreotide.Approved, Investigational
VecuroniumVecuronium may increase the arrhythmogenic activities of Digoxin Immune Fab (Ovine).Approved
VeliparibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Veliparib.Investigational
VemurafenibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Vemurafenib.Approved
VenetoclaxDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Venetoclax.Approved
VerapamilVerapamil may increase the atrioventricular blocking (AV block) activities of Digoxin Immune Fab (Ovine).Approved
VerteporfinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Verteporfin.Approved, Investigational
VesnarinoneDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Vesnarinone.Investigational
VinblastineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Vinblastine.Approved
VincristineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Vincristine.Approved, Investigational
VindesineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Vindesine.Approved, Investigational
VinflunineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Vinflunine.Approved
VinorelbineDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Vinorelbine.Approved, Investigational
VintafolideDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Vintafolide.Investigational
VismodegibDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Vismodegib.Approved
Vitamin ADigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Vitamin A.Approved, Nutraceutical, Vet Approved
VorinostatDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Vorinostat.Approved, Investigational
VorozoleDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Vorozole.Experimental
Zoptarelin doxorubicinThe serum concentration of Digoxin Immune Fab (Ovine) can be decreased when it is combined with Zoptarelin doxorubicin.Investigational
ZorubicinDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Zorubicin.Experimental
Zuretinol acetateDigoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Zuretinol acetate.Investigational
Food Interactions
Not Available

References

General References
Not Available
External Links
PubChem Substance
46506432
PharmGKB
PA164769030
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Digoxin_Immune_Fab
ATC Codes
V03AB24 — Digitalis antitoxin
AHFS Codes
  • 92:12.00 — Antidotes
  • 80:04.00 — Serums

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
2CompletedTreatmentBipolar Disorder (BD)1
2CompletedTreatmentProphylaxis of preeclampsia1
2RecruitingTreatmentSevere Preeclampsia1
4Unknown StatusTreatmentHemodialysis-dependent patients / High Blood Pressure (Hypertension)1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Dosage forms
FormRouteStrength
Powder, for solutionIntravenous38 mg
Injection, powder, for solutionIntravenous40 mg/1
Injection, powder, lyophilized, for solutionIntravenous38 mg/1
Powder, for solutionIntravenous40 mg
Prices
Unit descriptionCostUnit
Digibind 38 mg vial727.91USD vial
Digifab 40 mg vial615.6USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Not Available

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °C (FAB fragment)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.343Not Available
isoelectric point8.01Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Small molecule
Organism
Human
Pharmacological action
Yes
Actions
Other/unknown
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
  3. McMillin GA, Owen WE, Lambert TL, De BK, Frank EL, Bach PR, Annesley TM, Roberts WL: Comparable effects of DIGIBIND and DigiFab in thirteen digoxin immunoassays. Clin Chem. 2002 Sep;48(9):1580-4. [PubMed:12194938]
  4. Chhatre S, Thillaivinayagalingam P, Francis R, Titchener-Hooker NJ, Newcombe AR, Keshavarz-Moore E: Decision-support software for the industrial-scale chromatographic purification of antibodies. Biotechnol Prog. 2007 Jul-Aug;23(4):888-94. Epub 2007 Jul 13. [PubMed:17630695]
  5. Thillaivinayagalingam P, Newcombe AR, O'Donovan K, Francis R, Keshavarz-Moore E: Detection and quantification of affinity ligand leaching and specific antibody fragment concentration within chromatographic fractions using surface plasmon resonance. Biotechnol Appl Biochem. 2007 Dec;48(Pt 4):179-88. [PubMed:17516918]
  6. Betten DP, Vohra RB, Cook MD, Matteucci MJ, Clark RF: Antidote use in the critically ill poisoned patient. J Intensive Care Med. 2006 Sep-Oct;21(5):255-77. [PubMed:16946442]

Drug created on June 13, 2005 07:24 / Updated on December 10, 2017 17:18