Alemtuzumab

Identification

Name
Alemtuzumab
Accession Number
DB00087  (BTD00109, BIOD00109)
Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Humanized monoclonal antibody specific to lymphocyte antigens. It is a recombinant DNA-derived humanized monoclonal antibody (Campath-1H) that is directed against the 21-28 kD cell surface glycoprotein,CD52. The Campath-1H antibody is an IgG1 kappa with human variable framework and constant regions, and complementarity-determining regions from a murine (rat) monoclonal antibody (Campath-1G). Campath is produced in mammalian cell (Chinese hamster ovary) suspension culture in a medium containing neomycin.

Protein structure
Db00087
Protein chemical formula
C6468H10066N1732O2005S40
Protein average weight
145453.8 Da
Sequences
>1CE1:H CAMPATH-1H:Heavy Chain 1
QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTT
EYNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>1CE1:L CAMPATH-1H:Light Chain 1
DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNR
>1CE1:H CAMPATH-1H:Heavy Chain 2
QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTT
EYNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>1CE1:L CAMPATH-1H:Light Chain 2
DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNR
>1bey_H|CAMPATH-1H|Humanized||VH-CH1 (VH(1-121)+CH1(122-210))|||||||219||||MW 23397.3|MW 23397.3|
QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTT
EYNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV
>1bey_L|CAMPATH-1H|Humanized||L-KAPPA (V-KAPPA(1-107)+C-KAPPA(108-214))|||||||214||||MW 23571.3|MW 23571.3|
DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>8005_H|alemtuzumab|||H-GAMMA-1 (VH(1-121)+CH1(122-219)+HINGE-REGION(220-220)+CH2(221-330)+CH3(331-437))|||||||437||||MW 47976.2|MW 47976.2|
QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTT
EYNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEAPELLGGPSVFLFPPKPKDT
LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH
QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVK
GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE
ALHNHYTQKSLSLSPGK
>8005_L|alemtuzumab|||L-KAPPA (V-KAPPA(1-107)+C-KAPPA(108-214))|||||||214||||MW 23571.3|MW 23571.3|
DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>1ce1_H|CAMPATH-1H|Humanized||VH-CH1 (VH(1-121)+CH1(122-219))|||||||220||||MW 23526.4|MW 23526.4|
QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTT
EYNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
>1ce1_L|CAMPATH-1H|Humanized||L-KAPPA (V-KAPPA(1-107)+C-KAPPA(108-211))|||||||211||||MW 23282.0|MW 23282.0|
DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNR
Download FASTA Format
Synonyms
Not Available
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
CampathInjection30 mg/mLIntravenousGenzyme Corporation2009-11-30Not applicableUs
LemtradaInjection, solution, concentrate12 mg/1.2mLIntravenousGenzyme Corporation2014-11-18Not applicableUs
LemtradaSolution12 mgIntravenousSanofi Genzyme, a Division of Sanofi Aventis Canada Inc2014-01-29Not applicableCanada
MabcampathSolution10 mgIntravenousGenzyme Corporation2006-05-012008-08-07Canada
MabcampathSolution30 mgIntravenousSanofi Genzyme, a Division of Sanofi Aventis Canada Inc2007-09-07Not applicableCanada
Categories
UNII
3A189DH42V
CAS number
216503-57-0

Pharmacology

Indication

Alemtuzumab (Campath) is a monoclonal antibody therapy used for treatment of B-cell chronic lymphocytic leukemia.

Structured Indications
Pharmacodynamics

Campath is used to treat leukemia by exploiting antibody mediated lysis of CD52 presenting cells. The CD52 antigen is a cell surface protein found on essentially all B and T lymphocytes, a majority of monocytes, macrophages and most granulocytes. The CD52 antigen is not present on erythrocytes or hematopoetic stem cells. In leukemia there is an excess of B and T cells, so Campath permits selective reduction of lymphocyte populations.

Mechanism of action

Campath binds to the CD52 antigen present on most B and T lymphocytes. This binding leads to antibody-dependent lysis of leukemic cells.

TargetActionsOrganism
ACAMPATH-1 antigen
antibody
Human
ULow affinity immunoglobulin gamma Fc region receptor III-BNot AvailableHuman
UComplement C1r subcomponentNot AvailableHuman
UComplement C1q subcomponent subunit ANot AvailableHuman
UComplement C1q subcomponent subunit BNot AvailableHuman
UComplement C1q subcomponent subunit CNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor III-ANot AvailableHuman
UHigh affinity immunoglobulin gamma Fc receptor INot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-aNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-bNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-cNot AvailableHuman
Absorption
Not Available
Volume of distribution
  • 0.18 L/kg
Protein binding
Not Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system when bound to B or T lymphocytes

Route of elimination
Not Available
Half life

~288 hrs

Clearance
Not Available
Toxicity
Not Available
Affected organisms
Not Available
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Alemtuzumab.Approved
AcetyldigoxinAcetyldigoxin may decrease the cardiotoxic activities of Alemtuzumab.Experimental
BCG vaccineThe therapeutic efficacy of BCG vaccine can be decreased when used in combination with Alemtuzumab.Investigational
BelimumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Belimumab.Approved
BevacizumabBevacizumab may increase the cardiotoxic activities of Alemtuzumab.Approved, Investigational
CabazitaxelThe risk or severity of adverse effects can be increased when Cabazitaxel is combined with Alemtuzumab.Approved
Clostridium tetani toxoid antigen (formaldehyde inactivated)The therapeutic efficacy of Clostridium tetani toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Alemtuzumab.Approved
ClozapineThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Clozapine.Approved
Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated)The therapeutic efficacy of Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Alemtuzumab.Approved
CyclophosphamideCyclophosphamide may increase the cardiotoxic activities of Alemtuzumab.Approved, Investigational
CymarinCymarin may decrease the cardiotoxic activities of Alemtuzumab.Experimental
DenosumabThe risk or severity of adverse effects can be increased when Denosumab is combined with Alemtuzumab.Approved
DeslanosideDeslanoside may decrease the cardiotoxic activities of Alemtuzumab.Approved
DigitoxinDigitoxin may decrease the cardiotoxic activities of Alemtuzumab.Approved, Investigational
DigoxinDigoxin may decrease the cardiotoxic activities of Alemtuzumab.Approved
Digoxin Immune Fab (Ovine)Digoxin Immune Fab (Ovine) may decrease the cardiotoxic activities of Alemtuzumab.Approved
DocetaxelThe risk or severity of adverse effects can be increased when Docetaxel is combined with Alemtuzumab.Approved, Investigational
FingolimodAlemtuzumab may increase the immunosuppressive activities of Fingolimod.Approved, Investigational
G17DTThe therapeutic efficacy of G17DT can be decreased when used in combination with Alemtuzumab.Investigational
GI-5005The therapeutic efficacy of GI-5005 can be decreased when used in combination with Alemtuzumab.Investigational
GitoformateGitoformate may decrease the cardiotoxic activities of Alemtuzumab.Experimental
Hepatitis A VaccineThe therapeutic efficacy of Hepatitis A Vaccine can be decreased when used in combination with Alemtuzumab.Approved
Hepatitis B Vaccine (Recombinant)The therapeutic efficacy of Hepatitis B Vaccine (Recombinant) can be decreased when used in combination with Alemtuzumab.Approved, Withdrawn
INGN 201The therapeutic efficacy of INGN 201 can be decreased when used in combination with Alemtuzumab.Investigational
INGN 225The therapeutic efficacy of INGN 225 can be decreased when used in combination with Alemtuzumab.Investigational
Lanatoside CLanatoside C may decrease the cardiotoxic activities of Alemtuzumab.Experimental
LeflunomideThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Leflunomide.Approved, Investigational
MetamizoleThe risk or severity of adverse effects can be increased when Metamizole is combined with Alemtuzumab.Investigational, Withdrawn
MetildigoxinMetildigoxin may decrease the cardiotoxic activities of Alemtuzumab.Experimental
NatalizumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Natalizumab.Approved, Investigational
OleandrinOleandrin may decrease the cardiotoxic activities of Alemtuzumab.Experimental, Investigational
OuabainOuabain may decrease the cardiotoxic activities of Alemtuzumab.Approved
PaclitaxelThe risk or severity of adverse effects can be increased when Paclitaxel is combined with Alemtuzumab.Approved, Vet Approved
PeruvosidePeruvoside may decrease the cardiotoxic activities of Alemtuzumab.Experimental
PimecrolimusThe risk or severity of adverse effects can be increased when Pimecrolimus is combined with Alemtuzumab.Approved, Investigational
ProscillaridinProscillaridin may decrease the cardiotoxic activities of Alemtuzumab.Experimental
Rabies virus inactivated antigen, AThe therapeutic efficacy of Rabies virus inactivated antigen, A can be decreased when used in combination with Alemtuzumab.Approved
RindopepimutThe therapeutic efficacy of Rindopepimut can be decreased when used in combination with Alemtuzumab.Investigational
RoflumilastRoflumilast may increase the immunosuppressive activities of Alemtuzumab.Approved
Rotavirus VaccineThe therapeutic efficacy of Rotavirus Vaccine can be decreased when used in combination with Alemtuzumab.Approved
Rubella virus vaccineThe therapeutic efficacy of Rubella virus vaccine can be decreased when used in combination with Alemtuzumab.Approved
Salmonella typhi ty21a live antigenThe therapeutic efficacy of Salmonella typhi ty21a live antigen can be decreased when used in combination with Alemtuzumab.Approved
Sipuleucel-TThe therapeutic efficacy of Sipuleucel-T can be decreased when used in combination with Alemtuzumab.Approved
SRP 299The therapeutic efficacy of SRP 299 can be decreased when used in combination with Alemtuzumab.Investigational
TacrolimusThe risk or severity of adverse effects can be increased when Tacrolimus is combined with Alemtuzumab.Approved, Investigational
TecemotideThe therapeutic efficacy of Tecemotide can be decreased when used in combination with Alemtuzumab.Investigational
TG4010The therapeutic efficacy of TG4010 can be decreased when used in combination with Alemtuzumab.Investigational
TofacitinibAlemtuzumab may increase the immunosuppressive activities of Tofacitinib.Approved, Investigational
TrastuzumabTrastuzumab may increase the cardiotoxic activities of Alemtuzumab.Approved, Investigational
Yellow fever vaccineThe therapeutic efficacy of Yellow fever vaccine can be decreased when used in combination with Alemtuzumab.Approved
Zoster vaccineThe therapeutic efficacy of Zoster vaccine can be decreased when used in combination with Alemtuzumab.Approved
Food Interactions
Not Available

References

General References
  1. Hale G, Bright S, Chumbley G, Hoang T, Metcalf D, Munro AJ, Waldmann H: Removal of T cells from bone marrow for transplantation: a monoclonal antilymphocyte antibody that fixes human complement. Blood. 1983 Oct;62(4):873-82. [PubMed:6349718]
  2. Riechmann L, Clark M, Waldmann H, Winter G: Reshaping human antibodies for therapy. Nature. 1988 Mar 24;332(6162):323-7. [PubMed:3127726]
External Links
PubChem Substance
46507379
ChEMBL
CHEMBL1201587
Therapeutic Targets Database
DAP000385
PharmGKB
PA164783958
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Alemtuzumab
ATC Codes
L04AA34 — Alemtuzumab
AHFS Codes
  • 10:00.00 — Antineoplastic Agents
MSDS
Download (39.4 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0RecruitingTreatmentX-Linked Chronic Granulomatious Disease1
0TerminatedTreatmentAllogeneic peripheral haematopoietic stem cell transplant / Neuroepithelial Tumor / Tumors, Solid1
1Active Not RecruitingTreatmentDisseminated Sclerosis1
1CompletedTreatmentChronic Graft Versus Host Disease1
1CompletedTreatmentChronic Lymphocytic Leukaemia (CLL)1
1CompletedTreatmentChronic Myeloproliferative Disorders / Leukemias / Malignant Lymphomas / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms1
1CompletedTreatmentCongenital Marrow Failures / Haemoglobinopathies congenital / Immunodeficiencies / Inborn Errors of Metabolism / Lysosomal Storage Diseases / Non Malignant Disorders / Sickle Cell / Thalassaemic disorders1
1CompletedTreatmentLeukemia, Lymphocytic, Chronic, B-Cell1
1CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)1
1CompletedTreatmentNon-Hodgkin's Lymphoma (NHL) / T-Cell Lymphomas1
1CompletedTreatmentSevere Combined Immunodeficiency1
1RecruitingTreatmentCD52 Positive Non-Hodgkin Lymphoma / DLBCL or High-grade B-cell Lymphoma NOS / High-grade B-cell Lymphoma / Non Hodgkin Lymphoma (NHL)1
1RecruitingTreatmentClear Cell Carcinoma / Ewing's Sarcoma (ES) / Gastrointestinal Tumors / Germ Cell Tumors / Hepatic Tumors / Malignant Lymphomas / Melanoma / Neuroblastomas / Non-rhabdomyosarcoma / Renal Cell Adenocarcinoma / Rhabdoid Tumors / Rhabdomyosarcomas / Wilms' tumor1
1RecruitingTreatmentGraft Versus Host Disease (GVHD) / Sickle Cell Disorders1
1RecruitingTreatmentSickle Cell Disorders1
1TerminatedTreatmentCancer, Ovarian / Fallopian Tube Cancer / Malignant Peritoneal Neoplasm / Ovarian, Fallopian or Primary Peritoneal Cancer1
1TerminatedTreatmentGraft Versus Host Disease (GVHD) / Malignant Lymphomas / Myelodysplastic Syndrome / Myeloproliferative Disorders / Plasma Cell Myeloma1
1TerminatedTreatmentMalignancies, Hematologic1
1TerminatedTreatmentRecurrent Small Lymphocytic Lymphoma / Refractory Chronic Lymphocytic Leukemia / Stage III Chronic Lymphocytic Leukemia / Stage III Small Lymphocytic Lymphoma / Stage IV Chronic Lymphocytic Leukemia / Stage IV Small Lymphocytic Lymphoma1
1TerminatedTreatmentSclerosis, Progressive Systemic / Systemic Lupus Erythematosus (SLE)1
1Unknown StatusTreatmentMalignant Lymphomas / Small Intestine Cancer1
1WithdrawnNot AvailableNew Onset Type 1 Diabetes Mellitus1
1, 2Active Not RecruitingTreatmentAlemtuzumab (Campath ) / Graft Versus Host Disease (GVHD) / Peripheral Blood Stem Cell Transplantation / Sickle Cell Disorders / Sirolimus (Rapamune )1
1, 2Active Not RecruitingTreatmentB-Cell Chronic Lymphocytic Leukemia / Refractory Chronic Lymphocytic Leukemia / Stage 0 Chronic Lymphocytic Leukemia / Stage I Chronic Lymphocytic Leukemia / Stage II Chronic Lymphocytic Leukemia1
1, 2Active Not RecruitingTreatmentLeukaemia, Acute / Lymphoma, Hodgkins / Multiple Myeloma (MM) / Myelodysplastic Syndrome / Non-Hodgkin's Disease1
1, 2Active Not RecruitingTreatmentLeukemia, Lymphocytic, Chronic, B-Cell1
1, 2Active Not RecruitingTreatmentLeukemias / Malignant Lymphomas / Plasma Cell Myeloma1
1, 2CompletedTreatmentAcute Undifferentiated Leukemia (AUL) / B-cell Adult Acute Lymphoblastic Leukemia / B-cell Childhood Acute Lymphoblastic Leukemia / L1 Adult Acute Lymphoblastic Leukemia / L1 Childhood Acute Lymphoblastic Leukemia / L2 Adult Acute Lymphoblastic Leukemia / L2 Childhood Acute Lymphoblastic Leukemia / Philadelphia Chromosome Negative Adult Precursor Acute Lymphoblastic Leukemia / Philadelphia Chromosome Positive Adult Precursor Acute Lymphoblastic Leukemia / Philadelphia Chromosome Positive Childhood Precursor Acute Lymphoblastic Leukemia / T-cell Adult Acute Lymphoblastic Leukemia / T-cell Childhood Acute Lymphoblastic Leukemia / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia1
1, 2CompletedTreatmentAdvanced Hematologic Malignancies / Leukemias / Myelodysplastic Syndrome1
1, 2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias / Malignant Lymphomas1
1, 2CompletedTreatmentKidney Diseases / Renal Failure / Transplantation, Kidney1
1, 2CompletedTreatmentKidney Diseases / Transplantation, Kidney1
1, 2CompletedTreatmentLeukemia, Lymphocytic1
1, 2CompletedTreatmentLeukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms1
1, 2CompletedTreatmentMalignancies, Hematologic1
1, 2CompletedTreatmentPeripheral T-Cell Lymphoma (PTCL)1
1, 2Not Yet RecruitingTreatmentDiabetes, Diabetes Mellitus Type 11
1, 2RecruitingPreventionDisseminated Sclerosis1
1, 2RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Acute Myelogenous Leukaemia (AML) / Chronic Myeloid Leukemia (CML) / Juvenile Myelomonocytic Leukemia (JMML) / Lymphoma (Hodgkin's and Non-Hodgkin's) / Myelodysplastic Syndromes (MDS)1
1, 2RecruitingTreatmentBeta Thalassemia-Major / Sickle Cell Disorders1
1, 2RecruitingTreatmentGraft Versus Host Disease (GVHD) / Sickle Cell Disorders / Thalassaemic disorders / Transplantation, Stem Cell1
1, 2RecruitingTreatmentHaemoglobinopathies congenital / Hematologic, Immune, or Bone Marrow Disorders / Metabolic Disorders / Non-malignant Disorders1
1, 2RecruitingTreatmentHemophagocytic Lymphohistiocytosis (HLH)1
1, 2RecruitingTreatmentSickle Cell Disorders2
1, 2TerminatedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Acute Myelogenous Leukaemia (AML) / Chronic Myelogenous Leukemia (CML) / Hematologic Diseases / Lymphoproliferative Disorders / Multiple Myeloma (MM) / Myelodysplastic and Myeloproliferative Disorders / Plasma Cell Dyscrasia1
1, 2TerminatedTreatmentAnemias / Immunodeficiencies / Leukemias / Malignant Lymphomas / Neuroblastomas1
1, 2TerminatedTreatmentChronic Myelogenous Leukemia (CML) / Leukemias / Lymphoma, Hodgkins / Malignant Lymphomas / Multiple Myeloma (MM) / Myelodysplastic Syndrome1
1, 2TerminatedTreatmentCongenital Hypoplastic Anemia / Severe Aplastic Anemia (SAA)1
1, 2TerminatedTreatmentDisorder Related to Renal Transplantation1
1, 2TerminatedTreatmentGraft Versus Host Disease (GVHD) / Leukemias / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
1, 2TerminatedTreatmentLeukemias / Myeloproliferative Disorders / Plasma Cell Myeloma1
1, 2TerminatedTreatmentNon-Hodgkin's Lymphoma (NHL)2
1, 2TerminatedTreatmentSevere Combined Immunodeficiency Disease / Severe Primary Immunodeficiency Disorder / Undefined T Cell Deficiency Disorder / Wiskott-Aldrick Syndrome1
1, 2Unknown StatusTreatmentAcute Lymphoblastic Leukaemias (ALL)1
1, 2Unknown StatusTreatmentEnd-Stage Renal Disease (ESRD) / Renal Failure1
1, 2Unknown StatusTreatmentMalignant Lymphomas1
2Active Not RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Adult B Acute Lymphoblastic Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / Adult B Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Untreated Adult Acute Lymphoblastic Leukemia1
2Active Not RecruitingTreatmentAcute Undifferentiated Leukemia (AUL) / Adult Acute Lymphoblastic Leukemia in Remission / Adult Acute Myeloid Leukemia in Remission / Adult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / Atypical Chronic Myeloid Leukemia, BCR-ABL1 Negative / Childhood Acute Lymphoblastic Leukemia in Remission / Childhood Acute Myeloid Leukemia in Remission / Childhood Burkitt Lymphoma / Childhood Chronic Myelogenous Leukemia / Childhood Diffuse Large Cell Lymphoma / Childhood Immunoblastic Large Cell Lymphoma / Childhood Myelodysplastic Syndromes / Childhood Nasal Type Extranodal NK/T-cell Lymphoma / Chronic Myelomonocytic Leukemia / Chronic Phase Chronic Myelogenous Leukemia / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Hepatosplenic T-Cell Lymphoma / Intraocular Lymphoma / Juvenile Myelomonocytic Leukemia / Malignant mast cell neoplasm / Myelodysplastic/Myeloproliferative Neoplasm, Unclassifiable / Nodal marginal zone B-cell lymphomas / Noncutaneous Extranodal Lymphoma / Peripheral T-Cell Lymphoma (PTCL) / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Acute Myeloid Leukemia / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Myeloid Leukemia / Recurrent Childhood Anaplastic Large Cell Lymphoma / Recurrent Childhood Grade III Lymphomatoid Granulomatosis / Recurrent Childhood Large Cell Lymphoma / Recurrent Childhood Lymphoblastic Lymphoma / Recurrent Childhood Small Noncleaved Cell Lymphoma / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Small Lymphocytic Lymphoma / Recurrent/Refractory Childhood Hodgkin Lymphoma / Refractory Chronic Lymphocytic Leukemia / Refractory Hairy Cell Leukemia / Refractory Multiple Myeloma / Relapsing Chronic Myelogenous Leukemia / Secondary Myelodysplastic Syndromes / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / Testicular Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
2Active Not RecruitingTreatmentAdrenoleukodystrophy (ALD) / Alpha Mannosidosis / Aspartylglucosaminuria / Fucosidosis / Hunter Syndrome / Hurler's Syndrome / Krabbe's Disease / Metachromatic Leukodystrophy (MLD) / Mucopolysaccharidosis / Mucopolysaccharidosis VI / Peroxisomal Disorders / Sly Syndrome / Sphingolipidoses1
2Active Not RecruitingTreatmentAdult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Del(5q) / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Adult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / Childhood Burkitt Lymphoma / Childhood Chronic Myelogenous Leukemia / Childhood Diffuse Large Cell Lymphoma / Childhood Immunoblastic Large Cell Lymphoma / Childhood Nasal Type Extranodal NK/T-cell Lymphoma / Chronic Phase Chronic Myelogenous Leukemia / Contiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Contiguous Stage II Grade 1 Follicular Lymphoma / Contiguous Stage II Grade 2 Follicular Lymphoma / Contiguous Stage II Marginal Zone Lymphoma / Contiguous Stage II Small Lymphocytic Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Hepatosplenic T-Cell Lymphoma / Myelodysplastic/Myeloproliferative Neoplasm, Unclassifiable / Nodal marginal zone B-cell lymphomas / Noncontiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Noncontiguous Stage II Grade 1 Follicular Lymphoma / Noncontiguous Stage II Grade 2 Follicular Lymphoma / Noncontiguous Stage II Marginal Zone Lymphoma / Noncontiguous Stage II Small Lymphocytic Lymphoma / Peripheral T-Cell Lymphoma (PTCL) / Previously Treated Myelodysplastic Syndromes / Progressive Hairy Cell Leukemia, Initial Treatment / Recurrent Adult Acute Myeloid Leukemia / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Myeloid Leukemia / Recurrent Childhood Anaplastic Large Cell Lymphoma / Recurrent Childhood Large Cell Lymphoma / Recurrent Childhood Lymphoblastic Lymphoma / Recurrent Childhood Small Noncleaved Cell Lymphoma / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Small Lymphocytic Lymphoma / Recurrent/Refractory Childhood Hodgkin Lymphoma / Refractory Chronic Lymphocytic Leukemia / Refractory Hairy Cell Leukemia / Refractory Multiple Myeloma / Relapsing Chronic Myelogenous Leukemia / Splenic Marginal Zone Lymphoma / Stage I Adult Diffuse Small Cleaved Cell Lymphoma / Stage I Childhood Anaplastic Large Cell Lymphoma / Stage I Childhood Large Cell Lymphoma / Stage I Cutaneous T-cell Non-Hodgkin Lymphoma / Stage I Grade 1 Follicular Lymphoma / Stage I Grade 2 Follicular Lymphoma / Stage I Mantle Cell Lymphoma / Stage I Marginal Zone Lymphoma / Stage I Mycosis Fungoides/Sezary Syndrome / Stage I Small Lymphocytic Lymphoma / Stage II Childhood Anaplastic Large Cell Lymphoma / Stage II Childhood Large Cell Lymphoma / Stage II Cutaneous T-cell Non-Hodgkin Lymphoma / Stage II Mycosis Fungoides/Sezary Syndrome / Stage III Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Small Cleaved Cell Lymphoma / Stage III Childhood Anaplastic Large Cell Lymphoma / Stage III Childhood Large Cell Lymphoma / Stage III Cutaneous T-Cell Non-Hodgkin Lymphoma / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Mantle Cell Lymphoma / Stage III Marginal Zone Lymphoma / Stage III Mycosis Fungoides/Sezary Syndrome / Stage III Small Lymphocytic Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Small Cleaved Cell Lymphoma / Stage IV Childhood Anaplastic Large Cell Lymphoma / Stage IV Childhood Large Cell Lymphoma / Stage IV Cutaneous T-Cell Non-Hodgkin Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Mantle Cell Lymphoma / Stage IV Marginal Zone Lymphoma / Stage IV Mycosis Fungoides/Sezary Syndrome / Stage IV Small Lymphocytic Lymphoma / T-Cell Large Granular Lymphocyte Leukemia / Waldenstrom's Macroglobulinemia (WM)1
2Active Not RecruitingTreatmentChronic Granulomatous Disease (CGD)1
2Active Not RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL)1
2Active Not RecruitingTreatmentHemoglobinuria, Paroxysmal Nocturnal (PNH) / Juvenile Myelomonocytic Leukemia (JMML) / Leukemia Acute Myeloid Leukemia (AML) / Leukemia, Acute Lymphocytic (ALL) / Leukemia, Myeloid, Chronic(CML) / Lymphoma, Hodgkins / Lymphoma, Non-Hodgkin (NHL) / Myelodysplastic Syndromes (MDS)1
2Active Not RecruitingTreatmentImmunodeficiency Syndrome / Non-Cancer Diagnosis1
2Active Not RecruitingTreatmentLeukemias2
2Active Not RecruitingTreatmentLymphoma, Extranodal NK-T-Cell / T-Cell Lymphomas1
2Active Not RecruitingTreatmentLymphoma, Hodgkins / Lymphoma, Large B-Cell, Diffuse (DLBCL)1
2Active Not RecruitingTreatmentLymphoproliferative Disorders1
2Active Not RecruitingTreatmentMalignant Lymphomas1
2Active Not RecruitingTreatmentRelapsed or Refractory Severe Aplastic Anemia / Severe Aplastic Anemia (SAA)1
2Active Not RecruitingTreatmentSickle Cell Disorders1
2Active Not RecruitingTreatmentStage I Chronic Lymphocytic Leukemia / Stage II Chronic Lymphocytic Leukemia / Stage III Chronic Lymphocytic Leukemia / Stage IV Chronic Lymphocytic Leukemia1
2Active Not RecruitingTreatmentTransplantation, Organ1
2CompletedPreventionImmunosuppression / Kidney Failure,Chronic / Transplantation, Kidney1
2CompletedSupportive CareCancer, Breast / Cancer, Ovarian / Chronic Myeloproliferative Disorders / Gestational Trophoblastic Disease / Graft Versus Host Disease (GVHD) / Leukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases / Neuroblastomas / Testicular germ cell tumour2
2CompletedTreatmentALEMTUZUMAB/NATALIZUMAB [VA Drug Interaction] / Evidence of Liver Transplantation / Rejection1
2CompletedTreatmentAcute Myelogenous Leukaemia (AML) / Aplastic Anaemia (AA) / Chronic Lymphocytic Leukaemia (CLL) / Chronic Myelogenous Leukemia (CML) / Hodgkins Disease (HD) / Leukemia, Lymphocytic / Malignant Lymphomas / Myelodysplastic Syndromes / Myeloproliferative Disorders1
2CompletedTreatmentAcute T-Cell Leukemia-Lymphoma1
2CompletedTreatmentAdrenoleukodystrophy / Gangliosidosis, GM1 / I-Cell Disease / Leukodystrophy, Globoid Cell / Metachromatic Leukodystrophy / Sandhoffs Disease / Sanfilippo Syndrome / Tay Sachs Disease / Wolman's Disease1
2CompletedTreatmentAdult Acute Lymphocytic Leukemia T-Cell / Lymphoma, Lymphoblastic1
2CompletedTreatmentAgnogenic Myeloid Metaplasia / Aplastic Anaemia (AA) / Multiple Myeloma (MM) / Neoplasms, Hematologic / Paroxysmal Hemoglobinuria1
2CompletedTreatmentAplastic Anaemia (AA)1
2CompletedTreatmentB-CLL1
2CompletedTreatmentB-Cell Chronic Lymphocytic Leukemia1
2CompletedTreatmentB-Cell Chronic Lymphocytic Leukemia (B-CLL)1
2CompletedTreatmentB-Cell Chronic Lymphocytic Leukemia / Stage I Chronic Lymphocytic Leukemia / Stage II Chronic Lymphocytic Leukemia / Stage III Chronic Lymphocytic Leukemia / Stage IV Chronic Lymphocytic Leukemia1
2CompletedTreatmentChronic Leukemias / Chronic Lymphocytic Leukaemia (CLL) / Leukemia, B-Cell / Leukemias1
2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL)4
2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias2
2CompletedTreatmentCongenital Amegakaryocytic Thrombocytopenia / Congenital Hypoplastic Anemia / Leukemias / Myelodysplastic Syndromes / Severe Congenital Neutropenia1
2CompletedTreatmentDiabetes, Diabetes Mellitus Type 12
2CompletedTreatmentGraft Versus Host Disease (GVHD) / Transplantation, Bone Marrow1
2CompletedTreatmentHaemoglobinopathies congenital / Sickle Cell Disorders / Thalassaemic disorders1
2CompletedTreatmentInclusion Body Myositis (IBM)1
2CompletedTreatmentKidney Diseases / Rejection, Transplant1
2CompletedTreatmentLeukemia, Prolymphocytic / Leukemias1
2CompletedTreatmentLeukemias7
2CompletedTreatmentLeukemias / Malignant Lymphomas2
2CompletedTreatmentLeukemias / Malignant Lymphomas / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms1
2CompletedTreatmentLiver Diseases / Transplantation, Liver1
2CompletedTreatmentLymphocytic Leukemia, Chronic / Small Lymphocytic Lymphoma (SLL)1
2CompletedTreatmentLymphoma, T-Cell, Peripheral1
2CompletedTreatmentMyelodysplastic Syndromes1
2CompletedTreatmentParoxysmal Nocturnal Haemoglobinuria (PNH) / Pure Red Cell Aplasia / Severe Aplastic Anemia (SAA) / Sickle Cell Disorders1
2CompletedTreatmentPeripheral T-Cell Lymphoma (PTCL)2
2CompletedTreatmentRecurrent Childhood Acute Lymphoblastic Leukemia1
2CompletedTreatmentRelapsing Remitting Multiple Sclerosis (RRMS)1
2CompletedTreatmentT-cell-prolymphocytic Leukemia1
2RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Chronic Myelogenous Leukemia (CML) / Familial Hemophagocytic Lymphohistiocytosis (FLH) / Hemophagocytic Lymphohistiocytosis (HLH) / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndrome / Non Hodgkins Lymphoma / Viral-associated Hemophagocytic Syndrome (VAHS) / X-linked Lymphoproliferative Disease (XLP)1
2RecruitingTreatmentAplastic Anaemia (AA) / Dyskeratosis Congenita / Hoyeraal Hreidarsson Syndrome / Revesz Syndrome1
2RecruitingTreatmentB-Cell Chronic Lymphocytic Leukemia1
2RecruitingTreatmentBeta Thalassemia / Bone Marrow Failure / Histiocytosis / Immunodeficiencies / Inborn Errors of Metabolism / Leukemias / Malignant Lymphomas / Sickle Cell Disorders1
2RecruitingTreatmentBeta Thalassemia / Sickle Cell Disorders1
2RecruitingTreatmentCLL / SLL1
2RecruitingTreatmentCongenital Bone Marrow Failure Syndromes / Hereditary Anemias / Inflammatory Conditions / Inherited Metabolic Disorders (IMD) / Patients With Sickle Disease Presenting Specific Symptoms / Primary Immunodeficiency (PID) / Primary Immunodeficiency Syndromes1
2RecruitingTreatmentCongenital Hemolytic Anemia / Congenital Hypoplastic Anemia1
2RecruitingTreatmentHematopoietic Stem Cell Transplant (HSCT) / Leukemia Acute Myeloid Leukemia (AML) / Myelodysplastic Syndromes (MDS)1
2RecruitingTreatmentLeukemia, Erythroblastic, Acute / Myelodysplastic Syndromes1
2RecruitingTreatmentLeukemias1
2RecruitingTreatmentPure Red Cell Aplasia / Red Blood Cell Disorder / Sickle Cell Disorders / Stem Cell Transplant Complications1
2SuspendedTreatmentUnrecognized Condition: Mature B or T-cell Neoplasm1
2TerminatedDiagnosticMalignant Lymphomas1
2TerminatedTreatmentAplastic Anaemia (AA)1
2TerminatedTreatmentAutoimmune Cytopenias1
2TerminatedTreatmentChronic Lymphocytic Leukaemia (CLL)1
2TerminatedTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias1
2TerminatedTreatmentChronic Myeloproliferative Disorders / Leukemias / Myelodysplastic Syndromes1
2TerminatedTreatmentDisseminated Sclerosis1
2TerminatedTreatmentGraft Versus Host Disease (GVHD)1
2TerminatedTreatmentHistiocytosis, Langerhans-Cell1
2TerminatedTreatmentHodgkins Disease (HD) / Leukemias / Malignant Lymphomas / Multiple Myeloma (MM) / Neoplasms, Hematologic / Renal Cell Adenocarcinoma1
2TerminatedTreatmentLeukemia, Lymphocytic, Chronic, B-Cell / Lymphoma, Mantle-Cell1
2TerminatedTreatmentLeukemias2
2TerminatedTreatmentLeukemias / Malignant Lymphomas1
2TerminatedTreatmentLeukemias / Malignant Lymphomas / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
2TerminatedTreatmentLeukemias / Malignant Lymphomas / Myeloproliferative Disorders / Plasma Cell Myeloma1
2TerminatedTreatmentOsteopetrosis1
2TerminatedTreatmentPeripheral T-Cell Lymphoma (PTCL)1
2TerminatedTreatmentRecurrent Adult Acute Lymphoblastic Leukemia1
2TerminatedTreatmentSevere Combined Immunodeficiency1
2TerminatedTreatmentTransplantation, Kidney / Transplantation, Renal1
2Unknown StatusSupportive CareGraft Versus Host Disease (GVHD) / Nonneoplastic Condition1
2Unknown StatusTreatmentB-Cell Chronic Lymphocytic Leukemia2
2Unknown StatusTreatmentChronic Lymphocytic Leukaemia (CLL)1
2Unknown StatusTreatmentMalignant Lymphomas3
2Unknown StatusTreatmentMycosis Fungoides (MF) / Sezary Syndrome1
2Unknown StatusTreatmentNonmalignant Neoplasm1
2WithdrawnTreatmentHodgkins Disease (HD) / Malignant Lymphomas1
2WithdrawnTreatmentMalignant Lymphomas1
2, 3Active Not RecruitingTreatmentCongenital Hypoplastic Anemia / Severe Congenital Neutropenia / Shwachman-Diamond Syndrome / Sickle Cell Disorders / Thalassaemic disorders1
2, 3Active Not RecruitingTreatmentTransplantation, Kidney1
2, 3CompletedTreatmentAnemia, Hemolytic, Autoimmune / Idiopathic Thrombocytopenic Purpura (ITP)1
2, 3CompletedTreatmentLeukemias / Myelodysplastic Syndromes1
2, 3Unknown StatusTreatmentSevere Osteopetrosis1
3Active Not RecruitingTreatmentRelapsing Remitting Multiple Sclerosis (RRMS)1
3CompletedPreventionTransplantation, Kidney1
3CompletedTreatmentB Cell Chronic Lymphocytic Leukemia1
3CompletedTreatmentB-Cell Chronic Lymphocytic Leukemia1
3CompletedTreatmentLeukemias1
3CompletedTreatmentPancreas-Kidney Transplantation1
3CompletedTreatmentRelapsing Remitting Multiple Sclerosis (RRMS)3
3RecruitingTreatmentSickle Cell Disorders1
3Unknown StatusTreatmentAngioimmunoblastic Lymphadenopathy / Extranodal NK/T-cell Lymphoma / Peripheral T Cell Lymphoma, Unspecified1
3Unknown StatusTreatmentDisseminated Sclerosis1
4Active Not RecruitingPreventionRejection, Transplant1
4Active Not RecruitingTreatmentDisseminated Sclerosis1
4Active Not RecruitingTreatmentTransplantation, Renal1
4CompletedPreventionTransplant; Failure, Kidney1
4CompletedTreatmentLiving-Donor Kidney Transplants1
4CompletedTreatmentRelapsing Remitting Multiple Sclerosis (RRMS)1
4CompletedTreatmentTransplantation, Kidney1
4CompletedTreatmentTransplantation, Renal1
4Not Yet RecruitingTreatmentDisseminated Sclerosis1
4RecruitingBasic ScienceRelapsing Remitting Multiple Sclerosis (RRMS)1
4TerminatedTreatmentDiabetes Mellitus (DM)1
4TerminatedTreatmentKidney Transplant Failure and Rejection1
4TerminatedTreatmentTransplant, Kidney1
4Unknown StatusPreventionKidney Diseases / Renal Failure / Transplantation, Kidney1
4Unknown StatusTreatmentGranulomatosis With Polyangiitis / Microscopic Polyangiitis / Vasculitis / Wegener's1
4WithdrawnTreatmentChronic Inflammatory Demyelinating Neuropathy1
Not AvailableCompletedNot AvailableLeukemia, B-Cell, Chronic1
Not AvailableCompletedScreeningTransplantation, Kidney1
Not AvailableCompletedTreatmentGraft Versus Host Disease (GVHD)1
Not AvailableCompletedTreatmentHematological Neoplasms / Hematopoietic Stem Cell Transplantation (HSCT)1
Not AvailableCompletedTreatmentLeukemia, Lymphocytic, Acute / Leukemia, Lymphocytic, Chronic / Lymphoma, B-Cell / Lymphoma, Low-Grade / T-Cell Lymphomas1
Not AvailableCompletedTreatmentLeukemias1
Not AvailableCompletedTreatmentLeukemias / Malignant Lymphomas1
Not AvailableCompletedTreatmentMalignant Lymphomas1
Not AvailableCompletedTreatmentRenal Cancers1
Not AvailableNot Yet RecruitingTreatmentDisseminated Sclerosis1
Not AvailableRecruitingNot AvailableRelapsing Remitting Multiple Sclerosis (RRMS)1
Not AvailableRecruitingNot AvailableScleroderma1
Not AvailableRecruitingOtherAllogeneic Hematopoietic Cell Transplantation1
Not AvailableRecruitingTreatmentAplastic Anaemia (AA) / Dyskeratosis Congenita1
Not AvailableRecruitingTreatmentBare Lymphocyte Syndrome / CD40 Ligand Deficiency / Chediak-Higashi Syndrome / Chronic Granulomatous Disease (CGD) / Common Variable Immunodeficiency / Griscelli Syndrome / Hyper IgM Syndrome / Langerhan's Cell Histiocytosis / Lymphohistiocytosis, Hemophagocytic / Omenn's Syndrome / Reticular Dysgenesis / SCID / Wiskott-Aldrich Syndrome (WAS) / X-Linked Lymphoproliferative Disease1
Not AvailableRecruitingTreatmentLymphoma, Hodgkins / Non-Hodgkin's Lymphoma (NHL)1
Not AvailableSuspendedTreatmentBone Marrow Failure Syndromes / Congenital Immunodeficiency / Metabolic Diseases / Myeloid Malignancy / Severe Immune Dysregulation / Transfusion-dependent Red Blood Cell (RBC) Defect1
Not AvailableTerminatedNot AvailableChronic Lymphocytic Leukaemia (CLL)1
Not AvailableTerminatedTreatmentChronic Lymphocytic Leukaemia (CLL)1
Not AvailableTerminatedTreatmentLeukemias / Lymphoma, Hodgkins / Myeloproliferative Disorders / Non Hodgkin Lymphoma (NHL)1
Not AvailableTerminatedTreatmentThalassaemic disorders1
Not AvailableUnknown StatusTreatmentB-Cell Chronic Lymphocytic Leukemia1
Not AvailableWithdrawnTreatmentAplastic Anaemia (AA)1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Dosage forms
FormRouteStrength
InjectionIntravenous30 mg/mL
Injection, solution, concentrateIntravenous12 mg/1.2mL
SolutionIntravenous12 mg
SolutionIntravenous10 mg
SolutionIntravenous30 mg
Prices
Unit descriptionCostUnit
Campath 30 mg/ml Solution (1 Box Contains Three 1ml Vials)6179.24USD box
Campath 30 mg/ml vial2042.18USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1339198No1997-08-052014-08-05Canada

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.431Not Available
isoelectric point8.76Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antibody
General Function
Not Available
Specific Function
May play a role in carrying and orienting carbohydrate, as well as having a more specific role.
Gene Name
CD52
Uniprot ID
P31358
Uniprot Name
CAMPATH-1 antigen
Molecular Weight
6613.67 Da
References
  1. Gilliland LK, Walsh LA, Frewin MR, Wise MP, Tone M, Hale G, Kioussis D, Waldmann H: Elimination of the immunogenicity of therapeutic antibodies. J Immunol. 1999 Mar 15;162(6):3663-71. [PubMed:10092828]
  2. James LC, Hale G, Waldmann H, Bloomer AC: 1.9 A structure of the therapeutic antibody CAMPATH-1H fab in complex with a synthetic peptide antigen. J Mol Biol. 1999 Jun 4;289(2):293-301. [PubMed:10366506]
  3. Rawstron AC, Rollinson SJ, Richards S, Short MA, English A, Morgan GJ, Hale G, Hillmen P: The PNH phenotype cells that emerge in most patients after CAMPATH-1H therapy are present prior to treatment. Br J Haematol. 1999 Oct;107(1):148-53. [PubMed:10520035]
  4. Rebello PR, Hale G, Friend PJ, Cobbold SP, Waldmann H: Anti-globulin responses to rat and humanized CAMPATH-1 monoclonal antibody used to treat transplant rejection. Transplantation. 1999 Nov 15;68(9):1417-20. [PubMed:10573085]
  5. Hederer RA, Guntermann C, Miller N, Nagy P, Szollosi J, Damjanovich S, Hale G, Alexander DR: The CD45 tyrosine phosphatase regulates Campath-1H (CD52)-induced TCR-dependent signal transduction in human T cells. Int Immunol. 2000 Apr;12(4):505-16. [PubMed:10744652]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
  7. Geissinger E, Bonzheim I, Roth S, Rosenwald A, Muller-Hermelink HK, Rudiger T: CD52 expression in peripheral T-cell lymphomas determined by combined immunophenotyping using tumor cell specific T-cell receptor antibodies. Leuk Lymphoma. 2009 Jun;50(6):1010-6. doi: 10.1080/10428190902926981. [PubMed:19479612]
  8. Quintas-Cardama A, O'Brien S: Targeted therapy for chronic lymphocytic leukemia. Target Oncol. 2009 Jan;4(1):11-21. doi: 10.1007/s11523-008-0099-0. Epub 2009 Jan 27. [PubMed:19343298]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent...
Gene Name
FCGR3B
Uniprot ID
O75015
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-B
Molecular Weight
26215.64 Da
References
  1. Nagler A, Condiotti R, Lubina A, Deutsch VR: Enhancement of megakaryocytopoiesis by Campath-1G-treated natural killer cells. Bone Marrow Transplant. 1997 Oct;20(7):525-31. [PubMed:9337053]
  2. Brett S, Baxter G, Cooper H, Johnston JM, Tite J, Rapson N: Repopulation of blood lymphocyte sub-populations in rheumatoid arthritis patients treated with the depleting humanized monoclonal antibody, CAMPATH-1H. Immunology. 1996 May;88(1):13-9. [PubMed:8707338]
  3. Osterborg A, Werner A, Halapi E, Lundin J, Harmenberg U, Wigzell H, Mellstedt H: Clonal CD8+ and CD52- T cells are induced in responding B cell lymphoma patients treated with Campath-1H (anti-CD52). Eur J Haematol. 1997 Jan;58(1):5-13. [PubMed:9020367]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type peptidase activity
Specific Function
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name
C1R
Uniprot ID
P00736
Uniprot Name
Complement C1r subcomponent
Molecular Weight
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QA
Uniprot ID
P02745
Uniprot Name
Complement C1q subcomponent subunit A
Molecular Weight
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QB
Uniprot ID
P02746
Uniprot Name
Complement C1q subcomponent subunit B
Molecular Weight
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QC
Uniprot ID
P02747
Uniprot Name
Complement C1q subcomponent subunit C
Molecular Weight
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as...
Gene Name
FCGR3A
Uniprot ID
P08637
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-A
Molecular Weight
29088.895 Da
References
  1. Lin TS, Flinn IW, Modali R, Lehman TA, Webb J, Waymer S, Moran ME, Lucas MS, Farag SS, Byrd JC: FCGR3A and FCGR2A polymorphisms may not correlate with response to alemtuzumab in chronic lymphocytic leukemia. Blood. 2005 Jan 1;105(1):289-91. Epub 2004 Jun 24. [PubMed:15217834]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Receptor signaling protein activity
Specific Function
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name
FCGR1A
Uniprot ID
P12314
Uniprot Name
High affinity immunoglobulin gamma Fc receptor I
Molecular Weight
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized ...
Gene Name
FCGR2A
Uniprot ID
P12318
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-a
Molecular Weight
35000.42 Da
References
  1. Lin TS, Flinn IW, Modali R, Lehman TA, Webb J, Waymer S, Moran ME, Lucas MS, Farag SS, Byrd JC: FCGR3A and FCGR2A polymorphisms may not correlate with response to alemtuzumab in chronic lymphocytic leukemia. Blood. 2005 Jan 1;105(1):289-91. Epub 2004 Jun 24. [PubMed:15217834]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complex...
Gene Name
FCGR2B
Uniprot ID
P31994
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-b
Molecular Weight
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Transmembrane signaling receptor activity
Specific Function
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulat...
Gene Name
FCGR2C
Uniprot ID
P31995
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-c
Molecular Weight
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]

Drug created on June 13, 2005 07:24 / Updated on November 19, 2017 20:33