Identification
NameAlemtuzumab
Accession NumberDB00087  (BTD00109, BIOD00109)
TypeBiotech
GroupsApproved, Investigational
Description

Humanized monoclonal antibody specific to lymphocyte antigens. It is a recombinant DNA-derived humanized monoclonal antibody (Campath-1H) that is directed against the 21-28 kD cell surface glycoprotein,CD52. The Campath-1H antibody is an IgG1 kappa with human variable framework and constant regions, and complementarity-determining regions from a murine (rat) monoclonal antibody (Campath-1G). Campath is produced in mammalian cell (Chinese hamster ovary) suspension culture in a medium containing neomycin.

Protein structureDb00087
Related Articles
Protein chemical formulaC6468H10066N1732O2005S40
Protein average weight145453.8 Da
Sequences
>1CE1:H CAMPATH-1H:Heavy Chain 1
QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTT
EYNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>1CE1:L CAMPATH-1H:Light Chain 1
DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNR
>1CE1:H CAMPATH-1H:Heavy Chain 2
QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTT
EYNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>1CE1:L CAMPATH-1H:Light Chain 2
DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNR
>1bey_H|CAMPATH-1H|Humanized||VH-CH1 (VH(1-121)+CH1(122-210))|||||||219||||MW 23397.3|MW 23397.3|
QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTT
EYNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV
>1bey_L|CAMPATH-1H|Humanized||L-KAPPA (V-KAPPA(1-107)+C-KAPPA(108-214))|||||||214||||MW 23571.3|MW 23571.3|
DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>8005_H|alemtuzumab|||H-GAMMA-1 (VH(1-121)+CH1(122-219)+HINGE-REGION(220-220)+CH2(221-330)+CH3(331-437))|||||||437||||MW 47976.2|MW 47976.2|
QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTT
EYNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEAPELLGGPSVFLFPPKPKDT
LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH
QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVK
GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE
ALHNHYTQKSLSLSPGK
>8005_L|alemtuzumab|||L-KAPPA (V-KAPPA(1-107)+C-KAPPA(108-214))|||||||214||||MW 23571.3|MW 23571.3|
DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>1ce1_H|CAMPATH-1H|Humanized||VH-CH1 (VH(1-121)+CH1(122-219))|||||||220||||MW 23526.4|MW 23526.4|
QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTT
EYNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVE
>1ce1_L|CAMPATH-1H|Humanized||L-KAPPA (V-KAPPA(1-107)+C-KAPPA(108-211))|||||||211||||MW 23282.0|MW 23282.0|
DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNR
Download FASTA Format
SynonymsNot Available
External IDs Not Available
Product Ingredients Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
CampathInjection30 mg/mLIntravenousGenzyme Corporation2009-11-30Not applicableUs
LemtradaInjection, solution, concentrate12 mg/1.2mLIntravenousGenzyme Corporation2014-11-18Not applicableUs
LemtradaSolution12 mgIntravenousSanofi Genzyme, a Division of Sanofi Aventis Canada Inc2014-01-29Not applicableCanada
MabcampathSolution10 mgIntravenousGenzyme Corporation2006-05-012008-08-07Canada
MabcampathSolution30 mgIntravenousSanofi Genzyme, a Division of Sanofi Aventis Canada Inc2007-09-07Not applicableCanada
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
Categories
UNII3A189DH42V
CAS number216503-57-0
Pharmacology
Indication

Alemtuzumab (Campath) is a monoclonal antibody therapy used for treatment of B-cell chronic lymphocytic leukemia.

Structured Indications
Pharmacodynamics

Campath is used to treat leukemia by exploiting antibody mediated lysis of CD52 presenting cells. The CD52 antigen is a cell surface protein found on essentially all B and T lymphocytes, a majority of monocytes, macrophages and most granulocytes. The CD52 antigen is not present on erythrocytes or hematopoetic stem cells. In leukemia there is an excess of B and T cells, so Campath permits selective reduction of lymphocyte populations.

Mechanism of action

Campath binds to the CD52 antigen present on most B and T lymphocytes. This binding leads to antibody-dependent lysis of leukemic cells.

TargetKindPharmacological actionActionsOrganismUniProt ID
CAMPATH-1 antigenProteinyes
antibody
HumanP31358 details
Low affinity immunoglobulin gamma Fc region receptor III-BProteinunknownNot AvailableHumanO75015 details
Complement C1r subcomponentProteinunknownNot AvailableHumanP00736 details
Complement C1q subcomponent subunit AProteinunknownNot AvailableHumanP02745 details
Complement C1q subcomponent subunit BProteinunknownNot AvailableHumanP02746 details
Complement C1q subcomponent subunit CProteinunknownNot AvailableHumanP02747 details
Low affinity immunoglobulin gamma Fc region receptor III-AProteinunknownNot AvailableHumanP08637 details
High affinity immunoglobulin gamma Fc receptor IProteinunknownNot AvailableHumanP12314 details
Low affinity immunoglobulin gamma Fc region receptor II-aProteinunknownNot AvailableHumanP12318 details
Low affinity immunoglobulin gamma Fc region receptor II-bProteinunknownNot AvailableHumanP31994 details
Low affinity immunoglobulin gamma Fc region receptor II-cProteinunknownNot AvailableHumanP31995 details
Related Articles
AbsorptionNot Available
Volume of distribution
  • 0.18 L/kg
Protein bindingNot Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system when bound to B or T lymphocytes

Route of eliminationNot Available
Half life

~288 hrs

ClearanceNot Available
ToxicityNot Available
Affected organismsNot Available
PathwaysNot Available
Pharmacogenomic Effects/ADRs Not Available
Interactions
Drug Interactions
DrugInteractionDrug group
AcetyldigitoxinAcetyldigitoxin may decrease the cardiotoxic activities of Alemtuzumab.Approved
BelimumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Belimumab.Approved
BevacizumabBevacizumab may increase the cardiotoxic activities of Alemtuzumab.Approved, Investigational
CabazitaxelThe risk or severity of adverse effects can be increased when Cabazitaxel is combined with Alemtuzumab.Approved
ClozapineThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Clozapine.Approved
CyclophosphamideCyclophosphamide may increase the cardiotoxic activities of Alemtuzumab.Approved, Investigational
DenosumabThe risk or severity of adverse effects can be increased when Denosumab is combined with Alemtuzumab.Approved
DeslanosideDeslanoside may decrease the cardiotoxic activities of Alemtuzumab.Approved
DigitoxinDigitoxin may decrease the cardiotoxic activities of Alemtuzumab.Approved
DigoxinDigoxin may decrease the cardiotoxic activities of Alemtuzumab.Approved
DocetaxelThe risk or severity of adverse effects can be increased when Docetaxel is combined with Alemtuzumab.Approved, Investigational
FingolimodAlemtuzumab may increase the immunosuppressive activities of Fingolimod.Approved, Investigational
G17DTThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with G17DT.Investigational
INGN 201The risk or severity of adverse effects can be increased when Alemtuzumab is combined with INGN 201.Investigational
INGN 225The risk or severity of adverse effects can be increased when Alemtuzumab is combined with INGN 225.Investigational
LeflunomideThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Leflunomide.Approved, Investigational
MetamizoleThe risk or severity of adverse effects can be increased when Metamizole is combined with Alemtuzumab.Withdrawn
NatalizumabThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with Natalizumab.Approved, Investigational
OleandrinAnvirzel may decrease the cardiotoxic activities of Alemtuzumab.Experimental
OuabainOuabain may decrease the cardiotoxic activities of Alemtuzumab.Approved
PaclitaxelThe risk or severity of adverse effects can be increased when Paclitaxel is combined with Alemtuzumab.Approved, Vet Approved
PimecrolimusThe risk or severity of adverse effects can be increased when Pimecrolimus is combined with Alemtuzumab.Approved, Investigational
RindopepimutThe risk or severity of adverse effects can be increased when Alemtuzumab is combined with CDX-110.Investigational
RoflumilastRoflumilast may increase the immunosuppressive activities of Alemtuzumab.Approved
Sipuleucel-TThe therapeutic efficacy of Sipuleucel-T can be decreased when used in combination with Alemtuzumab.Approved
SRP 299The risk or severity of adverse effects can be increased when Alemtuzumab is combined with SRP 299.Investigational
TacrolimusThe risk or severity of adverse effects can be increased when Tacrolimus is combined with Alemtuzumab.Approved, Investigational
TofacitinibAlemtuzumab may increase the immunosuppressive activities of Tofacitinib.Approved, Investigational
TrastuzumabTrastuzumab may increase the cardiotoxic activities of Alemtuzumab.Approved, Investigational
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Hale G, Bright S, Chumbley G, Hoang T, Metcalf D, Munro AJ, Waldmann H: Removal of T cells from bone marrow for transplantation: a monoclonal antilymphocyte antibody that fixes human complement. Blood. 1983 Oct;62(4):873-82. [PubMed:6349718 ]
  2. Riechmann L, Clark M, Waldmann H, Winter G: Reshaping human antibodies for therapy. Nature. 1988 Mar 24;332(6162):323-7. [PubMed:3127726 ]
External Links
ATC CodesL04AA34
AHFS Codes
  • 10:00.00
PDB Entries
FDA labelNot Available
MSDSDownload (39.4 KB)
Clinical Trials
Clinical Trials
PhaseStatusPurposeConditionsCount
0RecruitingTreatmentX-Linked Chronic Granulomatious Disease1
1Active Not RecruitingTreatmentMultiple Sclerosis (MS)1
1CompletedTreatmentChronic Graft Versus Host Disease1
1CompletedTreatmentChronic Lymphocytic Leukaemia (CLL)1
1CompletedTreatmentChronic Myeloproliferative Disorders / Leukemias / Lymphoma NOS / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms1
1CompletedTreatmentCongenital Marrow Failures / Hemoglobinopathies / Immunodeficiencies / Inborn Errors of Metabolism / Lysosomal Storage Diseases / Non Malignant Disorders / Sickle Cell / Thalassemias1
1CompletedTreatmentLeukemia, Lymphocytic, Chronic, B-Cell1
1CompletedTreatmentNon-Hodgkin's Lymphoma (NHL)1
1CompletedTreatmentNon-Hodgkin's Lymphoma (NHL) / T-Cell Lymphomas1
1CompletedTreatmentSevere Combined Immunodeficiency1
1Not Yet RecruitingTreatmentCD52 Positive Non-Hodgkin Lymphoma / DLBCL or High-grade B-cell Lymphoma NOS / High-grade B-cell Lymphoma / Non Hodgkin Lymphoma (NHL)1
1RecruitingTreatmentClear Cell Carcinoma / Gastrointestinal Tumors / Germ Cell Tumors / Hepatic Tumors / Lymphoma NOS / Melanoma / Neuroblastomas / Non-rhabdomyosarcoma / Renal Cell Carcinoma (RCC) / Rhabdoid Tumors / Rhabdomyosarcomas / Sarcoma, Ewing's / Wilms Tumor1
1RecruitingTreatmentGraft Versus Host Disease (GVHD) / Sickle Cells Disease1
1RecruitingTreatmentSickle Cells Disease1
1TerminatedTreatmentCancer, Ovarian / Fallopian Tube Cancer / Ovarian, Fallopian or Primary Peritoneal Cancer / Peritoneal Cancer1
1TerminatedTreatmentGraft Versus Host Disease (GVHD) / Lymphoma NOS / Myelodysplastic Syndrome / Myelomas / Myeloproliferative Disorders1
1TerminatedTreatmentMalignancies, Hematologic1
1TerminatedTreatmentRecurrent Small Lymphocytic Lymphoma / Refractory Chronic Lymphocytic Leukemia / Stage III Chronic Lymphocytic Leukemia / Stage III Small Lymphocytic Lymphoma / Stage IV Chronic Lymphocytic Leukemia / Stage IV Small Lymphocytic Lymphoma1
1TerminatedTreatmentSystemic Lupus Erythematosus (SLE) / Systemic Sclerosis1
1Unknown StatusTreatmentLymphoma NOS / Small Intestine Cancer1
1WithdrawnNot AvailableNew Onset Type 1 Diabetes Mellitus1
1, 2Active Not RecruitingTreatmentAlemtuzumab (Campath ) / Graft Versus Host Disease (GVHD) / Peripheral Blood Stem Cell Transplantation / Sickle Cell Anemia / Sirolimus (Rapamune )1
1, 2Active Not RecruitingTreatmentB-Cell Chronic Lymphocytic Leukemia / Refractory Chronic Lymphocytic Leukemia / Stage 0 Chronic Lymphocytic Leukemia / Stage I Chronic Lymphocytic Leukemia / Stage II Chronic Lymphocytic Leukemia1
1, 2Active Not RecruitingTreatmentLeukaemia, Acute / Lymphoma, Hodgkins / Multiple Myeloma (MM) / Myelodysplastic Syndrome / Non-Hodgkin's Disease1
1, 2Active Not RecruitingTreatmentLeukemia, Lymphocytic, Chronic, B-Cell1
1, 2Active Not RecruitingTreatmentLeukemias / Lymphoma NOS / Myelomas1
1, 2CompletedTreatmentAcute Undifferentiated Leukemia (AUL) / B-cell Adult Acute Lymphoblastic Leukemia / B-cell Childhood Acute Lymphoblastic Leukemia / L1 Adult Acute Lymphoblastic Leukemia / L1 Childhood Acute Lymphoblastic Leukemia / L2 Adult Acute Lymphoblastic Leukemia / L2 Childhood Acute Lymphoblastic Leukemia / Philadelphia Chromosome Negative Adult Precursor Acute Lymphoblastic Leukemia / Philadelphia Chromosome Positive Adult Precursor Acute Lymphoblastic Leukemia / Philadelphia Chromosome Positive Childhood Precursor Acute Lymphoblastic Leukemia / T-cell Adult Acute Lymphoblastic Leukemia / T-cell Childhood Acute Lymphoblastic Leukemia / Untreated Adult Acute Lymphoblastic Leukemia / Untreated Childhood Acute Lymphoblastic Leukemia1
1, 2CompletedTreatmentAdvanced Hematologic Malignancies / Leukemias / Myelodysplastic Syndrome1
1, 2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias / Lymphoma NOS1
1, 2CompletedTreatmentKidney Diseases / Kidney Failure / Transplantation, Kidney1
1, 2CompletedTreatmentKidney Diseases / Transplantation, Kidney1
1, 2CompletedTreatmentLeukemia, Lymphocytic1
1, 2CompletedTreatmentLeukemias / Lymphoma NOS / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms1
1, 2CompletedTreatmentMalignancies, Hematologic1
1, 2CompletedTreatmentPeripheral T-Cell Lymphoma (PTCL)1
1, 2RecruitingPreventionMultiple Sclerosis (MS)1
1, 2RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Acute Myelogenous Leukaemia (AML) / Chronic Myeloid Leukemia (CML) / Juvenile Myelomonocytic Leukemia (JMML) / Lymphoma (Hodgkin's and Non-Hodgkin's) / Myelodysplastic Syndromes (MDS)1
1, 2RecruitingTreatmentBeta Thalassemia-Major / Sickle Cells Disease1
1, 2RecruitingTreatmentGraft Versus Host Disease (GVHD) / Sickle Cells Disease / Thalassemias / Transplantation, Stem Cell1
1, 2RecruitingTreatmentHematologic, Immune, or Bone Marrow Disorders / Hemoglobinopathies / Metabolic Disorders / Non-malignant Disorders1
1, 2RecruitingTreatmentHemophagocytic Lymphohistiocytosis (HLH)1
1, 2RecruitingTreatmentSickle Cells Disease2
1, 2TerminatedTreatmentAcute Lymphoblastic Leukaemias (ALL) / Acute Myelogenous Leukaemia (AML) / Chronic Myelogenous Leukemia (CML) / Hematologic Diseases / Lymphoproliferative Disorders / Multiple Myeloma (MM) / Myelodysplastic and Myeloproliferative Disorders / Plasma Cell Dyscrasia1
1, 2TerminatedTreatmentAnemias / Immunodeficiencies / Leukemias / Lymphoma NOS / Neuroblastomas1
1, 2TerminatedTreatmentChronic Myelogenous Leukemia (CML) / Leukemias / Lymphoma NOS / Lymphoma, Hodgkins / Multiple Myeloma (MM) / Myelodysplastic Syndrome1
1, 2TerminatedTreatmentCongenital Hypoplastic Anemia / Severe Aplastic Anemia (SAA)1
1, 2TerminatedTreatmentDisorder Related to Renal Transplantation1
1, 2TerminatedTreatmentGraft Versus Host Disease (GVHD) / Leukemias / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
1, 2TerminatedTreatmentLeukemias / Myelomas / Myeloproliferative Diseases1
1, 2TerminatedTreatmentNon-Hodgkin's Lymphoma (NHL)2
1, 2TerminatedTreatmentSevere Combined Immunodeficiency Disease / Severe Primary Immunodeficiency Disorder / Undefined T Cell Deficiency Disorder / Wiskott-Aldrick Syndrome1
1, 2Unknown StatusTreatmentAcute Lymphoblastic Leukaemias (ALL)1
1, 2Unknown StatusTreatmentEnd-Stage Renal Disease (ESRD) / Kidney Failure1
1, 2Unknown StatusTreatmentLymphoma NOS1
2Active Not RecruitingTreatmentAcute Undifferentiated Leukemia (AUL) / Adult Acute Lymphoblastic Leukemia in Remission / Adult Acute Myeloid Leukemia in Remission / Adult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / Atypical Chronic Myeloid Leukemia, BCR-ABL1 Negative / Childhood Acute Lymphoblastic Leukemia in Remission / Childhood Acute Myeloid Leukemia in Remission / Childhood Burkitt Lymphoma / Childhood Chronic Myelogenous Leukemia / Childhood Diffuse Large Cell Lymphoma / Childhood Immunoblastic Large Cell Lymphoma / Childhood Myelodysplastic Syndromes / Childhood Nasal Type Extranodal NK/T-cell Lymphoma / Chronic Myelomonocytic Leukemia / Chronic Phase Chronic Myelogenous Leukemia / Cutaneous B-Cell Non-Hodgkin Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Hepatosplenic T-Cell Lymphoma / Intraocular Lymphoma / Juvenile Myelomonocytic Leukemia / Mast Cell Leukemia (MCL) / Myelodysplastic/Myeloproliferative Neoplasm, Unclassifiable / Nodal marginal zone B-cell lymphomas / Noncutaneous Extranodal Lymphoma / Peripheral T-Cell Lymphoma (PTCL) / Previously Treated Myelodysplastic Syndromes / Recurrent Adult Acute Lymphoblastic Leukemia / Recurrent Adult Acute Myeloid Leukemia / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Myeloid Leukemia / Recurrent Childhood Anaplastic Large Cell Lymphoma / Recurrent Childhood Grade III Lymphomatoid Granulomatosis / Recurrent Childhood Large Cell Lymphoma / Recurrent Childhood Lymphoblastic Lymphoma / Recurrent Childhood Small Noncleaved Cell Lymphoma / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Small Lymphocytic Lymphoma / Recurrent/Refractory Childhood Hodgkin Lymphoma / Refractory Chronic Lymphocytic Leukemia / Refractory Hairy Cell Leukemia / Refractory Multiple Myeloma / Relapsing Chronic Myelogenous Leukemia / Secondary Myelodysplastic Syndromes / Small Intestine Lymphoma / Splenic Marginal Zone Lymphoma / Testicular Lymphoma / Waldenstrom's Macroglobulinemia (WM)1
2Active Not RecruitingTreatmentAdrenoleukodystrophy (ALD) / Alpha Mannosidosis / Aspartylglucosaminuria / Fucosidosis / Hunter Syndrome / Hurler's Syndrome / Krabbe's Disease / Maroteaux-Lamy Syndrome / Metachromatic Leukodystrophy (MLD) / Mucopolysaccharidosis / Peroxisomal Disorders / Sly Syndrome / Sphingolipidoses1
2Active Not RecruitingTreatmentAdult Acute Myeloid Leukemia With 11q23 (MLL) Abnormalities / Adult Acute Myeloid Leukemia With Del(5q) / Adult Acute Myeloid Leukemia With Inv(16)(p13;q22) / Adult Acute Myeloid Leukemia With T(15;17)(q22;q12) / Adult Acute Myeloid Leukemia With T(16;16)(p13;q22) / Adult Acute Myeloid Leukemia With T(8;21)(q22;q22) / Adult Nasal Type Extranodal NK/T-Cell Lymphoma / Anaplastic Large Cell Lymphoma / Angioimmunoblastic T-Cell Lymphoma / Childhood Burkitt Lymphoma / Childhood Chronic Myelogenous Leukemia / Childhood Diffuse Large Cell Lymphoma / Childhood Immunoblastic Large Cell Lymphoma / Childhood Nasal Type Extranodal NK/T-cell Lymphoma / Chronic Phase Chronic Myelogenous Leukemia / Contiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Contiguous Stage II Grade 1 Follicular Lymphoma / Contiguous Stage II Grade 2 Follicular Lymphoma / Contiguous Stage II Marginal Zone Lymphoma / Contiguous Stage II Small Lymphocytic Lymphoma / Extranodal Marginal Zone B-cell Lymphoma of Mucosa-associated Lymphoid Tissue / Hepatosplenic T-Cell Lymphoma / Myelodysplastic/Myeloproliferative Neoplasm, Unclassifiable / Nodal marginal zone B-cell lymphomas / Noncontiguous Stage II Adult Diffuse Small Cleaved Cell Lymphoma / Noncontiguous Stage II Grade 1 Follicular Lymphoma / Noncontiguous Stage II Grade 2 Follicular Lymphoma / Noncontiguous Stage II Marginal Zone Lymphoma / Noncontiguous Stage II Small Lymphocytic Lymphoma / Peripheral T-Cell Lymphoma (PTCL) / Previously Treated Myelodysplastic Syndromes / Progressive Hairy Cell Leukemia, Initial Treatment / Recurrent Adult Acute Myeloid Leukemia / Recurrent Adult Burkitt Lymphoma / Recurrent Adult Diffuse Large Cell Lymphoma / Recurrent Adult Diffuse Mixed Cell Lymphoma / Recurrent Adult Diffuse Small Cleaved Cell Lymphoma / Recurrent Adult Grade III Lymphomatoid Granulomatosis / Recurrent Adult Hodgkin's Lymphoma / Recurrent Adult Immunoblastic Large Cell Lymphoma / Recurrent Adult Lymphoblastic Lymphoma / Recurrent Adult T-Cell Leukemia/Lymphoma / Recurrent Childhood Acute Lymphoblastic Leukemia / Recurrent Childhood Acute Myeloid Leukemia / Recurrent Childhood Anaplastic Large Cell Lymphoma / Recurrent Childhood Large Cell Lymphoma / Recurrent Childhood Lymphoblastic Lymphoma / Recurrent Childhood Small Noncleaved Cell Lymphoma / Recurrent Cutaneous T-Cell Non-Hodgkin Lymphoma / Recurrent Grade 1 Follicular Lymphoma / Recurrent Grade 2 Follicular Lymphoma / Recurrent Grade 3 Follicular Lymphoma / Recurrent Mantle Cell Lymphoma / Recurrent Marginal Zone Lymphoma / Recurrent Mycosis Fungoides/Sezary Syndrome / Recurrent Small Lymphocytic Lymphoma / Recurrent/Refractory Childhood Hodgkin Lymphoma / Refractory Chronic Lymphocytic Leukemia / Refractory Hairy Cell Leukemia / Refractory Multiple Myeloma / Relapsing Chronic Myelogenous Leukemia / Splenic Marginal Zone Lymphoma / Stage I Adult Diffuse Small Cleaved Cell Lymphoma / Stage I Childhood Anaplastic Large Cell Lymphoma / Stage I Childhood Large Cell Lymphoma / Stage I Cutaneous T-cell Non-Hodgkin Lymphoma / Stage I Grade 1 Follicular Lymphoma / Stage I Grade 2 Follicular Lymphoma / Stage I Mantle Cell Lymphoma / Stage I Marginal Zone Lymphoma / Stage I Mycosis Fungoides/Sezary Syndrome / Stage I Small Lymphocytic Lymphoma / Stage II Childhood Anaplastic Large Cell Lymphoma / Stage II Childhood Large Cell Lymphoma / Stage II Cutaneous T-cell Non-Hodgkin Lymphoma / Stage II Mycosis Fungoides/Sezary Syndrome / Stage III Adult Diffuse Large Cell Lymphoma / Stage III Adult Diffuse Small Cleaved Cell Lymphoma / Stage III Childhood Anaplastic Large Cell Lymphoma / Stage III Childhood Large Cell Lymphoma / Stage III Cutaneous T-Cell Non-Hodgkin Lymphoma / Stage III Grade 1 Follicular Lymphoma / Stage III Grade 2 Follicular Lymphoma / Stage III Mantle Cell Lymphoma / Stage III Marginal Zone Lymphoma / Stage III Mycosis Fungoides/Sezary Syndrome / Stage III Small Lymphocytic Lymphoma / Stage IV Adult Diffuse Large Cell Lymphoma / Stage IV Adult Diffuse Small Cleaved Cell Lymphoma / Stage IV Childhood Anaplastic Large Cell Lymphoma / Stage IV Childhood Large Cell Lymphoma / Stage IV Cutaneous T-Cell Non-Hodgkin Lymphoma / Stage IV Grade 1 Follicular Lymphoma / Stage IV Grade 2 Follicular Lymphoma / Stage IV Mantle Cell Lymphoma / Stage IV Marginal Zone Lymphoma / Stage IV Mycosis Fungoides/Sezary Syndrome / Stage IV Small Lymphocytic Lymphoma / T-Cell Large Granular Lymphocyte Leukemia / Waldenstrom's Macroglobulinemia (WM)1
2Active Not RecruitingTreatmentAdult B Acute Lymphoblastic Leukemia With t(9;22)(q34.1;q11.2); BCR-ABL1 / Adult B Acute Lymphoblastic Leukemia With t(9;22)(q34;q11.2); BCR-ABL1 / Untreated Adult Acute Lymphoblastic Leukemia1
2Active Not RecruitingTreatmentChronic Lymphocytic Leukaemia (CLL)1
2Active Not RecruitingTreatmentDiffuse Large B-Cell Lymphoma (DLBCL) / Lymphoma, Hodgkins1
2Active Not RecruitingTreatmentHemoglobinuria, Paroxysmal Nocturnal (PNH) / Juvenile Myelomonocytic Leukemia (JMML) / Leukemia, Acute Lymphocytic (ALL) / Leukemia, Myeloid, Acute(AML) / Leukemia, Myeloid, Chronic(CML) / Lymphoma, Hodgkins / Lymphoma, Non-Hodgkin (NHL) / Myelodysplastic Syndromes (MDS)1
2Active Not RecruitingTreatmentImmunodeficiency Syndrome / Non-Cancer Diagnosis1
2Active Not RecruitingTreatmentLeukemias2
2Active Not RecruitingTreatmentLymphoma NOS1
2Active Not RecruitingTreatmentLymphoma, Extranodal NK-T-Cell / T-Cell Lymphomas1
2Active Not RecruitingTreatmentRelapsed or Refractory Severe Aplastic Anemia / Severe Aplastic Anemia (SAA)1
2Active Not RecruitingTreatmentSickle Cells Disease1
2Active Not RecruitingTreatmentStage I Chronic Lymphocytic Leukemia / Stage II Chronic Lymphocytic Leukemia / Stage III Chronic Lymphocytic Leukemia / Stage IV Chronic Lymphocytic Leukemia1
2Active Not RecruitingTreatmentTransplantation, Organ1
2CompletedPreventionImmunosuppression / Kidney Failure,Chronic / Transplantation, Kidney1
2CompletedSupportive CareCancer, Breast / Cancer, Ovarian / Chronic Myeloproliferative Disorders / Gestational Trophoblastic Disease / Graft Versus Host Disease (GVHD) / Leukemias / Lymphoma NOS / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases / Neuroblastomas / Testicular germ cell tumour2
2CompletedTreatmentALEMTUZUMAB/NATALIZUMAB [VA Drug Interaction] / Evidence of Liver Transplantation / Rejection1
2CompletedTreatmentAcute Myelogenous Leukaemia (AML) / Aplastic Anaemia (AA) / Chronic Lymphocytic Leukaemia (CLL) / Chronic Myelogenous Leukemia (CML) / Hodgkins Disease (HD) / Leukemia, Lymphoid / Malignant Lymphomas / Myelodysplastic Syndromes / Myeloproliferative Disorders1
2CompletedTreatmentAcute T-Cell Leukemia-Lymphoma1
2CompletedTreatmentAdrenoleukodystrophy / Gangliosidosis, GM1 / I-Cell Disease / Leukodystrophy, Globoid Cell / Metachromatic Leukodystrophy / Sandhoffs Disease / Sanfilippo Syndrome / Tay Sachs Disease / Wolman's Disease1
2CompletedTreatmentAdult Acute Lymphocytic Leukemia T-Cell / Lymphoma, Lymphoblastic1
2CompletedTreatmentAplastic Anaemia (AA)1
2CompletedTreatmentAplastic Anaemia (AA) / Multiple Myeloma (MM) / Myelofibrosis / Neoplasms, Hematologic / Paroxysmal Hemoglobinuria1
2CompletedTreatmentB-CLL1
2CompletedTreatmentB-Cell Chronic Lymphocytic Leukemia1
2CompletedTreatmentB-Cell Chronic Lymphocytic Leukemia (B-CLL)1
2CompletedTreatmentB-Cell Chronic Lymphocytic Leukemia / Stage I Chronic Lymphocytic Leukemia / Stage II Chronic Lymphocytic Leukemia / Stage III Chronic Lymphocytic Leukemia / Stage IV Chronic Lymphocytic Leukemia1
2CompletedTreatmentChronic Leukemias / Chronic Lymphocytic Leukaemia (CLL) / Leukemia, B-Cell / Leukemias1
2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL)4
2CompletedTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias2
2CompletedTreatmentCongenital Amegakaryocytic Thrombocytopenia / Congenital Hypoplastic Anemia / Leukemias / Myelodysplastic Syndromes / Severe Congenital Neutropenia1
2CompletedTreatmentDiabetes, Diabetes Mellitus Type 12
2CompletedTreatmentGraft Rejection / Kidney Diseases1
2CompletedTreatmentGraft Versus Host Disease (GVHD) / Transplantation, Bone Marrow1
2CompletedTreatmentHemoglobinopathies / Sickle Cells Disease / Thalassemias1
2CompletedTreatmentInclusion Body Myositis (IBM)1
2CompletedTreatmentLeukemia, Prolymphocytic / Leukemias1
2CompletedTreatmentLeukemias7
2CompletedTreatmentLeukemias / Lymphoma NOS2
2CompletedTreatmentLeukemias / Lymphoma NOS / Multiple Myeloma and Plasma Cell Neoplasm / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Neoplasms1
2CompletedTreatmentLiver Diseases / Transplantation, Liver1
2CompletedTreatmentLymphocytic Leukemia, Chronic / Small Lymphocytic Lymphoma (SLL)1
2CompletedTreatmentLymphoma, T-Cell, Peripheral1
2CompletedTreatmentMyelodysplastic Syndromes1
2CompletedTreatmentParoxysmal Nocturnal Hemoglobinuria (PNH) / Pure Red Cell Aplasia / Severe Aplastic Anemia (SAA) / Sickle Cell Anemia1
2CompletedTreatmentPeripheral T-Cell Lymphoma (PTCL)2
2CompletedTreatmentRecurrent Childhood Acute Lymphoblastic Leukemia1
2CompletedTreatmentRelapsing Remitting Multiple Sclerosis (RRMS)1
2CompletedTreatmentT-cell-prolymphocytic Leukemia1
2RecruitingTreatmentAcute Lymphoblastic Leukaemias (ALL) / Acute Myeloid Leukaemias (AML) / Chronic Myelogenous Leukemia (CML) / Familial Hemophagocytic Lymphohistiocytosis (FLH) / Hemophagocytic Lymphohistiocytosis (HLH) / Myelodysplastic Syndrome / Non Hodgkins Lymphoma / Viral-associated Hemophagocytic Syndrome (VAHS) / X-linked Lymphoproliferative Disease (XLP)1
2RecruitingTreatmentAcute Myeloid Leukaemias (AML) / Hematopoietic Stem Cell Transplant (HSCT) / Myelodysplastic Syndromes (MDS)1
2RecruitingTreatmentAllogeneic Hematopoietic Stem Cell Transplantation / Neuroepithelial Tumor / Tumors, Solid1
2RecruitingTreatmentAplastic Anaemia (AA) / Dyskeratosis Congenita / Hoyeraal Hreidarsson Syndrome / Revesz Syndrome1
2RecruitingTreatmentB-Cell Chronic Lymphocytic Leukemia1
2RecruitingTreatmentBeta Thalassemia / Bone Marrow Failure / Histiocytosis / Immunodeficiencies / Inborn Errors of Metabolism / Leukemias / Lymphoma NOS / Sickle Cells Disease1
2RecruitingTreatmentBeta Thalassemia / Sickle Cells Disease1
2RecruitingTreatmentCLL / SLL1
2RecruitingTreatmentChronic Granulomatous Disease (CGD)1
2RecruitingTreatmentCongenital Bone Marrow Failure Syndromes / Hereditary Anemias / Inherited Metabolic Disorders (IMD) / Patients With Sickle Disease Presenting Specific Symptoms / Primary Immunodeficiency Syndromes1
2RecruitingTreatmentCongenital Hemolytic Anemia / Congenital Hypoplastic Anemia1
2RecruitingTreatmentLeukemia, Erythroblastic, Acute / Myelodysplastic Syndromes1
2RecruitingTreatmentLeukemias1
2RecruitingTreatmentLymphoproliferative Disorders1
2SuspendedTreatmentUnrecognized Condition: Mature B or T-cell Neoplasm1
2TerminatedDiagnosticLymphoma NOS1
2TerminatedTreatmentAplastic Anaemia (AA)1
2TerminatedTreatmentAutoimmune Cytopenias1
2TerminatedTreatmentChronic Lymphocytic Leukaemia (CLL)1
2TerminatedTreatmentChronic Lymphocytic Leukaemia (CLL) / Leukemias1
2TerminatedTreatmentChronic Myeloproliferative Disorders / Leukemias / Myelodysplastic Syndromes1
2TerminatedTreatmentGraft Versus Host Disease (GVHD)1
2TerminatedTreatmentHistiocytosis, Langerhans-Cell1
2TerminatedTreatmentHodgkins Disease (HD) / Leukemias / Lymphoma NOS / Multiple Myeloma (MM) / Neoplasms, Hematologic / Renal Cell Carcinoma (RCC)1
2TerminatedTreatmentLeukemia, Lymphocytic, Chronic, B-Cell / Lymphoma, Mantle-Cell1
2TerminatedTreatmentLeukemias2
2TerminatedTreatmentLeukemias / Lymphoma NOS1
2TerminatedTreatmentLeukemias / Lymphoma NOS / Myelodysplastic Syndromes / Myelodysplastic/Myeloproliferative Diseases1
2TerminatedTreatmentLeukemias / Lymphoma NOS / Myelomas / Myeloproliferative Diseases1
2TerminatedTreatmentMultiple Sclerosis (MS)1
2TerminatedTreatmentOsteopetrosis1
2TerminatedTreatmentPeripheral T-Cell Lymphoma (PTCL)1
2TerminatedTreatmentRecurrent Adult Acute Lymphoblastic Leukemia1
2TerminatedTreatmentSevere Combined Immunodeficiency1
2TerminatedTreatmentTransplantation, Kidney / Transplantation, Renal1
2Unknown StatusSupportive CareGraft Versus Host Disease (GVHD) / Nonneoplastic Condition1
2Unknown StatusTreatmentB-Cell Chronic Lymphocytic Leukemia2
2Unknown StatusTreatmentChronic Lymphocytic Leukaemia (CLL)1
2Unknown StatusTreatmentLymphoma NOS3
2Unknown StatusTreatmentMycosis Fungoides (MF) / Sezary Syndrome1
2Unknown StatusTreatmentNonmalignant Neoplasm1
2WithdrawnTreatmentHodgkins Disease (HD) / Lymphoma NOS1
2WithdrawnTreatmentLymphoma NOS1
2, 3Active Not RecruitingTreatmentCongenital Hypoplastic Anemia / Severe Congenital Neutropenia / Shwachman-Diamond Syndrome / Sickle Cells Disease / Thalassemias1
2, 3Active Not RecruitingTreatmentSevere Osteopetrosis1
2, 3Active Not RecruitingTreatmentTransplantation, Kidney1
2, 3CompletedTreatmentAnemia, Hemolytic, Autoimmune / Idiopathic Thrombocytopenic Purpura (ITP)1
2, 3CompletedTreatmentLeukemias / Myelodysplastic Syndromes1
3Active Not RecruitingTreatmentRelapsing Remitting Multiple Sclerosis (RRMS)1
3CompletedPreventionTransplantation, Kidney1
3CompletedTreatmentB Cell Chronic Lymphocytic Leukemia1
3CompletedTreatmentB-Cell Chronic Lymphocytic Leukemia1
3CompletedTreatmentLeukemias1
3CompletedTreatmentPancreas-Kidney Transplantation1
3CompletedTreatmentRelapsing Remitting Multiple Sclerosis (RRMS)3
3RecruitingTreatmentSickle Cells Disease1
3Unknown StatusTreatmentAngioimmunoblastic Lymphadenopathy / Extranodal NK/T-cell Lymphoma / Peripheral T Cell Lymphoma, Unspecified1
3Unknown StatusTreatmentMultiple Sclerosis (MS)1
4Active Not RecruitingPreventionGraft Rejection1
4Active Not RecruitingTreatmentMultiple Sclerosis (MS)1
4Active Not RecruitingTreatmentTransplantation, Renal1
4CompletedPreventionTransplant; Failure, Kidney1
4CompletedTreatmentLiving-Donor Kidney Transplants1
4CompletedTreatmentRelapsing Remitting Multiple Sclerosis (RRMS)1
4CompletedTreatmentTransplantation, Kidney1
4CompletedTreatmentTransplantation, Renal1
4RecruitingBasic ScienceRelapsing Remitting Multiple Sclerosis (RRMS)1
4TerminatedTreatmentDiabetes Mellitus (DM)1
4TerminatedTreatmentKidney Transplant Failure and Rejection1
4TerminatedTreatmentTransplant, Kidney1
4Unknown StatusPreventionKidney Diseases / Kidney Failure / Transplantation, Kidney1
4Unknown StatusTreatmentGranulomatosis With Polyangiitis / Microscopic Polyangiitis / Vasculitis / Wegener's1
4WithdrawnTreatmentChronic Inflammatory Demyelinating Neuropathy1
Not AvailableCompletedNot AvailableLeukemia, B-Cell, Chronic1
Not AvailableCompletedScreeningTransplantation, Kidney1
Not AvailableCompletedTreatmentGraft Versus Host Disease (GVHD)1
Not AvailableCompletedTreatmentHematological Neoplasms / Hematopoietic Stem Cell Transplantation (HSCT)1
Not AvailableCompletedTreatmentKidney Cancer1
Not AvailableCompletedTreatmentLeukemia, Lymphocytic, Acute / Leukemia, Lymphocytic, Chronic / Lymphoma, B-Cell / Lymphoma, Low-Grade / T-Cell Lymphomas1
Not AvailableCompletedTreatmentLeukemias1
Not AvailableCompletedTreatmentLeukemias / Lymphoma NOS1
Not AvailableCompletedTreatmentLymphoma NOS1
Not AvailableNot Yet RecruitingTreatmentMultiple Sclerosis (MS)1
Not AvailableRecruitingNot AvailableScleroderma1
Not AvailableRecruitingTreatmentAplastic Anaemia (AA) / Dyskeratosis Congenita1
Not AvailableRecruitingTreatmentBare Lymphocyte Syndrome / CD40 Ligand Deficiency / Chediak-Higashi Syndrome / Chronic Granulomatous Disease (CGD) / Common Variable Immunodeficiency / Griscelli Syndrome / Hyper IgM Syndrome / Langerhan's Cell Histiocytosis / Lymphohistiocytosis, Hemophagocytic / Omenn's Syndrome / Reticular Dysgenesis / SCID / Wiskott-Aldrich Syndrome (WAS) / X-Linked Lymphoproliferative Disease1
Not AvailableRecruitingTreatmentLymphoma, Hodgkins / Non-Hodgkin's Lymphoma (NHL)1
Not AvailableSuspendedTreatmentBone Marrow Failure Syndromes / Congenital Immunodeficiency / Metabolic Diseases / Myeloid Malignancy / Severe Immune Dysregulation / Transfusion-dependent Red Blood Cell (RBC) Defect1
Not AvailableTerminatedNot AvailableChronic Lymphocytic Leukaemia (CLL)1
Not AvailableTerminatedTreatmentChronic Lymphocytic Leukaemia (CLL)1
Not AvailableTerminatedTreatmentLeukemias / Lymphoma, Hodgkins / Myeloproliferative Disorders / Non Hodgkin Lymphoma (NHL)1
Not AvailableTerminatedTreatmentThalassemias1
Not AvailableUnknown StatusTreatmentB-Cell Chronic Lymphocytic Leukemia1
Not AvailableWithdrawnTreatmentAplastic Anaemia (AA)1
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
InjectionIntravenous30 mg/mL
Injection, solution, concentrateIntravenous12 mg/1.2mL
SolutionIntravenous12 mg
SolutionIntravenous10 mg
SolutionIntravenous30 mg
Prices
Unit descriptionCostUnit
Campath 30 mg/ml Solution (1 Box Contains Three 1ml Vials)6179.24USD box
Campath 30 mg/ml vial2042.18USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1339198 No1997-08-052014-08-05Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.431Not Available
isoelectric point8.76Not Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
antibody
General Function:
Not Available
Specific Function:
May play a role in carrying and orienting carbohydrate, as well as having a more specific role.
Gene Name:
CD52
Uniprot ID:
P31358
Molecular Weight:
6613.67 Da
References
  1. Gilliland LK, Walsh LA, Frewin MR, Wise MP, Tone M, Hale G, Kioussis D, Waldmann H: Elimination of the immunogenicity of therapeutic antibodies. J Immunol. 1999 Mar 15;162(6):3663-71. [PubMed:10092828 ]
  2. James LC, Hale G, Waldmann H, Bloomer AC: 1.9 A structure of the therapeutic antibody CAMPATH-1H fab in complex with a synthetic peptide antigen. J Mol Biol. 1999 Jun 4;289(2):293-301. [PubMed:10366506 ]
  3. Rawstron AC, Rollinson SJ, Richards S, Short MA, English A, Morgan GJ, Hale G, Hillmen P: The PNH phenotype cells that emerge in most patients after CAMPATH-1H therapy are present prior to treatment. Br J Haematol. 1999 Oct;107(1):148-53. [PubMed:10520035 ]
  4. Rebello PR, Hale G, Friend PJ, Cobbold SP, Waldmann H: Anti-globulin responses to rat and humanized CAMPATH-1 monoclonal antibody used to treat transplant rejection. Transplantation. 1999 Nov 15;68(9):1417-20. [PubMed:10573085 ]
  5. Hederer RA, Guntermann C, Miller N, Nagy P, Szollosi J, Damjanovich S, Hale G, Alexander DR: The CD45 tyrosine phosphatase regulates Campath-1H (CD52)-induced TCR-dependent signal transduction in human T cells. Int Immunol. 2000 Apr;12(4):505-16. [PubMed:10744652 ]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
  7. Geissinger E, Bonzheim I, Roth S, Rosenwald A, Muller-Hermelink HK, Rudiger T: CD52 expression in peripheral T-cell lymphomas determined by combined immunophenotyping using tumor cell specific T-cell receptor antibodies. Leuk Lymphoma. 2009 Jun;50(6):1010-6. doi: 10.1080/10428190902926981. [PubMed:19479612 ]
  8. Quintas-Cardama A, O'Brien S: Targeted therapy for chronic lymphocytic leukemia. Target Oncol. 2009 Jan;4(1):11-21. doi: 10.1007/s11523-008-0099-0. Epub 2009 Jan 27. [PubMed:19343298 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Gene Name:
FCGR3B
Uniprot ID:
O75015
Molecular Weight:
26215.64 Da
References
  1. Nagler A, Condiotti R, Lubina A, Deutsch VR: Enhancement of megakaryocytopoiesis by Campath-1G-treated natural killer cells. Bone Marrow Transplant. 1997 Oct;20(7):525-31. [PubMed:9337053 ]
  2. Brett S, Baxter G, Cooper H, Johnston JM, Tite J, Rapson N: Repopulation of blood lymphocyte sub-populations in rheumatoid arthritis patients treated with the depleting humanized monoclonal antibody, CAMPATH-1H. Immunology. 1996 May;88(1):13-9. [PubMed:8707338 ]
  3. Osterborg A, Werner A, Halapi E, Lundin J, Harmenberg U, Wigzell H, Mellstedt H: Clonal CD8+ and CD52- T cells are induced in responding B cell lymphoma patients treated with Campath-1H (anti-CD52). Eur J Haematol. 1997 Jan;58(1):5-13. [PubMed:9020367 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type peptidase activity
Specific Function:
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name:
C1R
Uniprot ID:
P00736
Molecular Weight:
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QA
Uniprot ID:
P02745
Molecular Weight:
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QB
Uniprot ID:
P02746
Molecular Weight:
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QC
Uniprot ID:
P02747
Molecular Weight:
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
Gene Name:
FCGR3A
Uniprot ID:
P08637
Molecular Weight:
29088.895 Da
References
  1. Lin TS, Flinn IW, Modali R, Lehman TA, Webb J, Waymer S, Moran ME, Lucas MS, Farag SS, Byrd JC: FCGR3A and FCGR2A polymorphisms may not correlate with response to alemtuzumab in chronic lymphocytic leukemia. Blood. 2005 Jan 1;105(1):289-91. Epub 2004 Jun 24. [PubMed:15217834 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Receptor signaling protein activity
Specific Function:
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name:
FCGR1A
Uniprot ID:
P12314
Molecular Weight:
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.
Gene Name:
FCGR2A
Uniprot ID:
P12318
Molecular Weight:
35000.42 Da
References
  1. Lin TS, Flinn IW, Modali R, Lehman TA, Webb J, Waymer S, Moran ME, Lucas MS, Farag SS, Byrd JC: FCGR3A and FCGR2A polymorphisms may not correlate with response to alemtuzumab in chronic lymphocytic leukemia. Blood. 2005 Jan 1;105(1):289-91. Epub 2004 Jun 24. [PubMed:15217834 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells ...
Gene Name:
FCGR2B
Uniprot ID:
P31994
Molecular Weight:
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Transmembrane signaling receptor activity
Specific Function:
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.
Gene Name:
FCGR2C
Uniprot ID:
P31995
Molecular Weight:
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23