Identification
NameAbciximab
Accession NumberDB00054  (BTD00041, BIOD00041)
TypeBiotech
GroupsApproved
DescriptionAbciximab is a Fab fragment of the chimeric human-murine monoclonal antibody 7E3. Abciximab binds to the glycoprotein (GP) IIb/IIIa receptor of human platelets and inhibits platelet aggregation by preventing the binding of fibrinogen, von Willebrand factor, and other adhesive molecules. It also binds to vitronectin (αvβ3) receptor found on platelets and vessel wall endothelial and smooth muscle cells.
Protein structureDb00054
Related Articles
Protein chemical formulaC6462H9964N1690O2049S48
Protein average weight145651.1 Da
Sequences
>1TXV:H ReoPro-like antibody Heavy Chain 1
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKY
DPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSA
KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE
LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>1TXV:L ReoPro-like antibody Light Chain 1
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPS
RFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>1TXV:H ReoPro-like antibody Heavy Chain 2
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKY
DPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSA
KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE
LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>1TXV:L ReoPro-like antibody Light Chain 2
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPS
RFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Download FASTA Format
Synonyms
7E3
7E3 antibody
antiGPIIBIIIa
C7E3
External IDs Not Available
Product Ingredients Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
ReoproSolution2 mgIntravenousJanssen Pharmaceuticals1996-10-30Not applicableCanada
ReoproInjection, solution2 mg/mLIntravenousEli Lilly & Co. Ltd.1993-12-16Not applicableUs
ReoproInjection, solution2 mg/mLIntravenousJanssen Biotech, Inc.2017-01-03Not applicableUs
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International BrandsNot Available
Brand mixturesNot Available
Categories
UNIIX85G7936GV
CAS number143653-53-6
Pharmacology
IndicationAbciximab is indicated as an adjunct to percutaneous coronary intervention for the prevention of cardiac ischemic complications in patients undergoing percutaneous coronary intervention and in patients with unstable angina not responding to conventional medical therapy when percutaneous coronary intervention is planned within 24 hours. Abciximab is intended for use with aspirin and heparin and has been studied only in that setting.
Structured Indications
PharmacodynamicsAbciximab inhibits platelet aggregation by preventing the binding of fibrinogen, von Willebrand factor, and other adhesive molecules to GPIIb/IIIa receptor sites on activated platelets. A single intravenous bolus dose from 0.15 mg/kg to 0.30 mg/kg produced rapid dose-dependent inhibition of platelet function. After two hours post-injection with a dose of 0.25 - 0.30 mg/kg, 80% of the GPIIb/IIIa receptors were blocked and platelet aggregation was prevented. GPIIb/IIIa is the major surface receptor involved in the final pathway of platelet aggregation. Bleeding time increases to over 30 minutes at the aforementioned doses. To compare, baseline values were five minutes.
Mechanism of actionAbciximab binds to the intact platelet GPIIb/IIIa receptor, which is a member of the integrin family of adhesion receptors and the major platelet surface receptor involved in platelet aggregation. This binding is thought to involve steric hindrance and/or conformational alterations which block access of large molecules to the receptor rather than direct interaction with the RGD (arginine-glycine-aspartic acid) binding site of GPIIb/IIIa. By binding to the vitronectin receptor (also known as the αvβ3 integrin), abciximab blocks effects mediated by this integrin which include cell adhesion. Furthermore, abciximab blocks Mac-1 receptor on monocytes and neutrophils thus inhibiting monocyte adhesion.
TargetKindPharmacological actionActionsOrganismUniProt ID
Integrin beta-3Proteinyes
antagonist
HumanP05106 details
Integrin alpha-IIbProteinyes
antagonist
HumanP08514 details
Low affinity immunoglobulin gamma Fc region receptor III-BProteinunknownNot AvailableHumanO75015 details
Complement C1r subcomponentProteinunknownNot AvailableHumanP00736 details
Complement C1q subcomponent subunit AProteinunknownNot AvailableHumanP02745 details
Complement C1q subcomponent subunit BProteinunknownNot AvailableHumanP02746 details
Complement C1q subcomponent subunit CProteinunknownNot AvailableHumanP02747 details
Low affinity immunoglobulin gamma Fc region receptor III-AProteinunknownNot AvailableHumanP08637 details
Complement C1s subcomponentProteinunknownNot AvailableHumanP09871 details
High affinity immunoglobulin gamma Fc receptor IProteinunknownNot AvailableHumanP12314 details
Low affinity immunoglobulin gamma Fc region receptor II-aProteinunknownNot AvailableHumanP12318 details
Low affinity immunoglobulin gamma Fc region receptor II-bProteinunknownNot AvailableHumanP31994 details
Low affinity immunoglobulin gamma Fc region receptor II-cProteinunknownNot AvailableHumanP31995 details
VitronectinProteinunknownNot AvailableHumanP04004 details
Related Articles
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system when bound to platelets, or by human antimurine antibody production. Excreted renally.

Route of eliminationNot Available
Half lifeFollowing intravenous bolus administration, free plasma concentrations of Abciximab decrease rapidly with an initial half-life of less than 10 minutes and a second phase half-life of about 30 minutes, probably related to rapid binding to the platelet GPIIb/IIIa receptors.
ClearanceNot Available
ToxicityNot Available
Affected organisms
  • Humans and other mammals
Pathways
PathwayCategorySMPDB ID
Abciximab Action PathwayDrug actionSMP00265
Pharmacogenomic Effects/ADRs
Interacting Gene/EnzymeAllele nameGenotype(s)Defining Change(s)Type(s)DescriptionDetails
Integrin beta-3GPIIIa PlA2(C;C) / (C;T)A2 Allele ADR Directly StudiedAssociated with greater restenosis and risk for subacute coronary thrombosis in patients administered antiplatelet therapy. Details
Interactions
Drug Interactions
DrugInteractionDrug group
AceclofenacAceclofenac may increase the anticoagulant activities of Abciximab.Approved
AcenocoumarolAbciximab may increase the anticoagulant activities of Acenocoumarol.Approved
Acetylsalicylic acidThe risk or severity of adverse effects can be increased when Abciximab is combined with Acetylsalicylic acid.Approved, Vet Approved
AdapaleneAdapalene may increase the anticoagulant activities of Abciximab.Approved
AllylestrenolThe therapeutic efficacy of Abciximab can be decreased when used in combination with Allylestrenol.Approved
AlprostadilAlprostadil may increase the anticoagulant activities of Abciximab.Approved, Investigational
AlteplaseAlteplase may increase the anticoagulant activities of Abciximab.Approved
Aminosalicylic AcidThe risk or severity of adverse effects can be increased when Abciximab is combined with Aminosalicylic Acid.Approved
AnagrelideAnagrelide may increase the anticoagulant activities of Abciximab.Approved
AncrodAbciximab may increase the anticoagulant activities of Ancrod.Investigational
AnistreplaseAnistreplase may increase the anticoagulant activities of Abciximab.Approved
AntipyrineAntipyrine may increase the anticoagulant activities of Abciximab.Approved
Antithrombin III humanAbciximab may increase the anticoagulant activities of Antithrombin III human.Approved
ApixabanApixaban may increase the anticoagulant activities of Abciximab.Approved
ApremilastApremilast may increase the anticoagulant activities of Abciximab.Approved, Investigational
AprotininThe therapeutic efficacy of Abciximab can be decreased when used in combination with Aprotinin.Approved, Withdrawn
ArdeparinAbciximab may increase the anticoagulant activities of Ardeparin.Approved, Withdrawn
ArgatrobanAbciximab may increase the anticoagulant activities of Argatroban.Approved, Investigational
AzapropazoneAzapropazone may increase the anticoagulant activities of Abciximab.Withdrawn
AzelastineAzelastine may increase the anticoagulant activities of Abciximab.Approved
BalsalazideBalsalazide may increase the anticoagulant activities of Abciximab.Approved, Investigational
BazedoxifeneBazedoxifene may decrease the anticoagulant activities of Abciximab.Approved, Investigational
BecaplerminAbciximab may increase the anticoagulant activities of Becaplermin.Approved, Investigational
BemiparinBemiparin may increase the anticoagulant activities of Abciximab.Approved
BenoxaprofenBenoxaprofen may increase the anticoagulant activities of Abciximab.Withdrawn
BeraprostBeraprost may increase the anticoagulant activities of Abciximab.Investigational
BivalirudinBivalirudin may increase the anticoagulant activities of Abciximab.Approved, Investigational
BromfenacBromfenac may increase the anticoagulant activities of Abciximab.Approved
CangrelorCangrelor may increase the anticoagulant activities of Abciximab.Approved
CarprofenCarprofen may increase the anticoagulant activities of Abciximab.Approved, Vet Approved, Withdrawn
CastanospermineCastanospermine may increase the anticoagulant activities of Abciximab.Experimental
CelecoxibCelecoxib may increase the anticoagulant activities of Abciximab.Approved, Investigational
CertoparinAbciximab may increase the anticoagulant activities of Certoparin.Approved
ChloroquineChloroquine may increase the anticoagulant activities of Abciximab.Approved, Vet Approved
ChlorotrianiseneChlorotrianisene may decrease the anticoagulant activities of Abciximab.Withdrawn
CilostazolCilostazol may increase the anticoagulant activities of Abciximab.Approved
Citric AcidAbciximab may increase the anticoagulant activities of Citric Acid.Nutraceutical, Vet Approved
ClonixinClonixin may increase the anticoagulant activities of Abciximab.Approved
ClopidogrelClopidogrel may increase the anticoagulant activities of Abciximab.Approved, Nutraceutical
Conjugated Equine EstrogensConjugated Equine Estrogens may decrease the anticoagulant activities of Abciximab.Approved
Dabigatran etexilateDabigatran etexilate may increase the anticoagulant activities of Abciximab.Approved
DalteparinAbciximab may increase the anticoagulant activities of Dalteparin.Approved
DasatinibDasatinib may increase the anticoagulant activities of Abciximab.Approved, Investigational
DeferasiroxThe risk or severity of adverse effects can be increased when Abciximab is combined with Deferasirox.Approved, Investigational
DefibrotideDefibrotide may increase the anticoagulant activities of Abciximab.Approved, Investigational
Deoxycholic AcidThe risk or severity of adverse effects can be increased when Abciximab is combined with Deoxycholic Acid.Approved
DesirudinAbciximab may increase the anticoagulant activities of Desirudin.Approved
DesmoteplaseDesmoteplase may increase the anticoagulant activities of Abciximab.Investigational
DesogestrelThe therapeutic efficacy of Abciximab can be decreased when used in combination with Desogestrel.Approved
DextranDextran may increase the anticoagulant activities of Abciximab.Approved, Vet Approved
Dextran 40Abciximab may increase the anticoagulant activities of Dextran 40.Approved
DiclofenacDiclofenac may increase the anticoagulant activities of Abciximab.Approved, Vet Approved
DicoumarolAbciximab may increase the anticoagulant activities of Dicoumarol.Approved
DienestrolDienestrol may decrease the anticoagulant activities of Abciximab.Approved
DienogestThe therapeutic efficacy of Abciximab can be decreased when used in combination with Dienogest.Approved
DiethylstilbestrolDiethylstilbestrol may decrease the anticoagulant activities of Abciximab.Approved
DiflunisalThe risk or severity of adverse effects can be increased when Abciximab is combined with Diflunisal.Approved
DipyridamoleDipyridamole may increase the anticoagulant activities of Abciximab.Approved
DitazoleDitazole may increase the anticoagulant activities of Abciximab.Approved, Withdrawn
DrospirenoneThe therapeutic efficacy of Abciximab can be decreased when used in combination with Drospirenone.Approved
Drotrecogin alfaDrotrecogin alfa may increase the anticoagulant activities of Abciximab.Approved, Investigational, Withdrawn
DroxicamDroxicam may increase the anticoagulant activities of Abciximab.Approved
DydrogesteroneThe therapeutic efficacy of Abciximab can be decreased when used in combination with Dydrogesterone.Approved, Withdrawn
Edetic AcidAbciximab may increase the anticoagulant activities of Edetic Acid.Approved, Vet Approved
EdoxabanEdoxaban may increase the anticoagulant activities of Abciximab.Approved
EnoxaparinAbciximab may increase the anticoagulant activities of Enoxaparin.Approved
EpinastineEpinastine may increase the anticoagulant activities of Abciximab.Approved, Investigational
EpirizoleEpirizole may increase the anticoagulant activities of Abciximab.Approved
EpoprostenolEpoprostenol may increase the antiplatelet activities of Abciximab.Approved
EptifibatideEptifibatide may increase the anticoagulant activities of Abciximab.Approved, Investigational
EstradiolEstradiol may decrease the anticoagulant activities of Abciximab.Approved, Investigational, Vet Approved
EstriolEstriol may decrease the anticoagulant activities of Abciximab.Approved, Vet Approved
EstroneEstrone may decrease the anticoagulant activities of Abciximab.Approved
EtanerceptEtanercept may increase the anticoagulant activities of Abciximab.Approved, Investigational
Ethinyl EstradiolEthinyl Estradiol may decrease the anticoagulant activities of Abciximab.Approved
Ethyl biscoumacetateAbciximab may increase the anticoagulant activities of Ethyl biscoumacetate.Withdrawn
Ethynodiol diacetateThe therapeutic efficacy of Abciximab can be decreased when used in combination with Ethynodiol diacetate.Approved
EtodolacEtodolac may increase the anticoagulant activities of Abciximab.Approved, Investigational, Vet Approved
EtofenamateEtofenamate may increase the anticoagulant activities of Abciximab.Approved
EtonogestrelThe therapeutic efficacy of Abciximab can be decreased when used in combination with Etonogestrel.Approved, Investigational
EtoricoxibEtoricoxib may increase the anticoagulant activities of Abciximab.Approved, Investigational
FenbufenFenbufen may increase the anticoagulant activities of Abciximab.Approved
FenoprofenFenoprofen may increase the anticoagulant activities of Abciximab.Approved
FibrinolysinFibrinolysin may increase the anticoagulant activities of Abciximab.Approved
FloctafenineFloctafenine may increase the anticoagulant activities of Abciximab.Approved, Withdrawn
FlurbiprofenFlurbiprofen may increase the anticoagulant activities of Abciximab.Approved, Investigational
Fondaparinux sodiumAbciximab may increase the anticoagulant activities of Fondaparinux sodium.Approved, Investigational
G17DTThe therapeutic efficacy of G17DT can be decreased when used in combination with Abciximab.Investigational
GabexateAbciximab may increase the anticoagulant activities of Gabexate.Investigational
GenisteinGenistein may decrease the anticoagulant activities of Abciximab.Investigational
GestodeneThe therapeutic efficacy of Abciximab can be decreased when used in combination with Gestodene.Approved
GestrinoneThe therapeutic efficacy of Abciximab can be decreased when used in combination with Gestrinone.Approved
GlucosamineGlucosamine may increase the antiplatelet activities of Abciximab.Approved
HeminHemin may increase the anticoagulant activities of Abciximab.Approved
HeparinAbciximab may increase the anticoagulant activities of Heparin.Approved, Investigational
HexestrolHexestrol may decrease the anticoagulant activities of Abciximab.Withdrawn
HMPL-004HMPL-004 may increase the anticoagulant activities of Abciximab.Investigational
Hydroxyprogesterone caproateThe therapeutic efficacy of Abciximab can be decreased when used in combination with Hydroxyprogesterone caproate.Approved
Ibritumomab tiuxetanThe risk or severity of adverse effects can be increased when Abciximab is combined with Ibritumomab tiuxetan.Approved
IbrutinibThe risk or severity of adverse effects can be increased when Ibrutinib is combined with Abciximab.Approved
IbudilastIbudilast may increase the anticoagulant activities of Abciximab.Approved, Investigational
IbuprofenIbuprofen may increase the anticoagulant activities of Abciximab.Approved
IbuproxamIbuproxam may increase the anticoagulant activities of Abciximab.Withdrawn
IcatibantIcatibant may increase the anticoagulant activities of Abciximab.Approved
Icosapent ethylIcosapent ethyl may increase the anticoagulant activities of Abciximab.Approved, Nutraceutical
IfenprodilIfenprodil may increase the anticoagulant activities of Abciximab.Approved, Withdrawn
IloprostIloprost may increase the antiplatelet activities of Abciximab.Approved, Investigational
IndomethacinIndomethacin may increase the anticoagulant activities of Abciximab.Approved, Investigational
IndoprofenIndoprofen may increase the anticoagulant activities of Abciximab.Withdrawn
INGN 201The therapeutic efficacy of INGN 201 can be decreased when used in combination with Abciximab.Investigational
INGN 225The therapeutic efficacy of INGN 225 can be decreased when used in combination with Abciximab.Investigational
IsoxicamIsoxicam may increase the anticoagulant activities of Abciximab.Withdrawn
KebuzoneKebuzone may increase the anticoagulant activities of Abciximab.Experimental
KetoprofenKetoprofen may increase the anticoagulant activities of Abciximab.Approved, Vet Approved
KetorolacKetorolac may increase the anticoagulant activities of Abciximab.Approved
LeflunomideLeflunomide may increase the anticoagulant activities of Abciximab.Approved, Investigational
LepirudinLepirudin may increase the anticoagulant activities of Abciximab.Approved
LevonorgestrelThe therapeutic efficacy of Abciximab can be decreased when used in combination with Levonorgestrel.Approved, Investigational
LimaprostThe risk or severity of adverse effects can be increased when Limaprost is combined with Abciximab.Approved
LornoxicamLornoxicam may increase the anticoagulant activities of Abciximab.Approved
LoxoprofenLoxoprofen may increase the anticoagulant activities of Abciximab.Approved
LumiracoxibLumiracoxib may increase the anticoagulant activities of Abciximab.Approved, Investigational
Magnesium salicylateMagnesium salicylate may increase the anticoagulant activities of Abciximab.Approved
MasoprocolMasoprocol may increase the anticoagulant activities of Abciximab.Approved
Meclofenamic acidMeclofenamic acid may increase the anticoagulant activities of Abciximab.Approved, Vet Approved
MedrogestoneThe therapeutic efficacy of Abciximab can be decreased when used in combination with Medrogestone.Approved
Medroxyprogesterone acetateThe therapeutic efficacy of Abciximab can be decreased when used in combination with Medroxyprogesterone acetate.Approved, Investigational
Mefenamic acidMefenamic acid may increase the anticoagulant activities of Abciximab.Approved
Megestrol acetateThe therapeutic efficacy of Abciximab can be decreased when used in combination with Megestrol acetate.Approved, Vet Approved
MeloxicamMeloxicam may increase the anticoagulant activities of Abciximab.Approved, Vet Approved
MesalazineThe risk or severity of adverse effects can be increased when Abciximab is combined with Mesalazine.Approved
MestranolMestranol may decrease the anticoagulant activities of Abciximab.Approved
MetamizoleMetamizole may increase the anticoagulant activities of Abciximab.Withdrawn
MethallenestrilMethallenestril may decrease the anticoagulant activities of Abciximab.Experimental
MilrinoneMilrinone may increase the anticoagulant activities of Abciximab.Approved
Mycophenolate mofetilMycophenolate mofetil may increase the anticoagulant activities of Abciximab.Approved, Investigational
Mycophenolic acidMycophenolic acid may increase the anticoagulant activities of Abciximab.Approved
NabumetoneNabumetone may increase the anticoagulant activities of Abciximab.Approved
NadroparinAbciximab may increase the anticoagulant activities of Nadroparin.Approved
NafamostatNafamostat may increase the anticoagulant activities of Abciximab.Approved, Investigational
NaftifineNaftifine may increase the anticoagulant activities of Abciximab.Approved
NaproxenNaproxen may increase the anticoagulant activities of Abciximab.Approved, Vet Approved
NCX 4016The risk or severity of adverse effects can be increased when Abciximab is combined with NCX 4016.Investigational
NepafenacNepafenac may increase the anticoagulant activities of Abciximab.Approved
Niflumic AcidNiflumic Acid may increase the anticoagulant activities of Abciximab.Approved
NimesulideNimesulide may increase the anticoagulant activities of Abciximab.Approved, Withdrawn
NintedanibThe risk or severity of adverse effects can be increased when Abciximab is combined with Nintedanib.Approved
NorethisteroneThe therapeutic efficacy of Abciximab can be decreased when used in combination with Norethisterone.Approved
ObinutuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Obinutuzumab.Approved
OlopatadineOlopatadine may increase the anticoagulant activities of Abciximab.Approved
OlsalazineOlsalazine may increase the anticoagulant activities of Abciximab.Approved
Omacetaxine mepesuccinateThe risk or severity of adverse effects can be increased when Abciximab is combined with Omacetaxine mepesuccinate.Approved
Omega-3 fatty acidsOmega-3 fatty acids may increase the anticoagulant activities of Abciximab.Approved, Nutraceutical
OxaprozinOxaprozin may increase the anticoagulant activities of Abciximab.Approved
OxyphenbutazoneOxyphenbutazone may increase the anticoagulant activities of Abciximab.Withdrawn
ParecoxibParecoxib may increase the anticoagulant activities of Abciximab.Approved
ParnaparinParnaparin may increase the anticoagulant activities of Abciximab.Approved
Pentosan PolysulfatePentosan Polysulfate may increase the anticoagulant activities of Abciximab.Approved
PentoxifyllinePentoxifylline may increase the antiplatelet activities of Abciximab.Approved, Investigational
PhenindioneAbciximab may increase the anticoagulant activities of Phenindione.Approved
PhenprocoumonAbciximab may increase the anticoagulant activities of Phenprocoumon.Approved
PhenylbutazonePhenylbutazone may increase the anticoagulant activities of Abciximab.Approved, Vet Approved
PimecrolimusPimecrolimus may increase the anticoagulant activities of Abciximab.Approved, Investigational
PirfenidonePirfenidone may increase the anticoagulant activities of Abciximab.Investigational
PiroxicamPiroxicam may increase the anticoagulant activities of Abciximab.Approved, Investigational
PlasminPlasmin may increase the anticoagulant activities of Abciximab.Investigational
PrasugrelPrasugrel may increase the anticoagulant activities of Abciximab.Approved
ProgesteroneThe therapeutic efficacy of Abciximab can be decreased when used in combination with Progesterone.Approved, Vet Approved
PropacetamolPropacetamol may increase the anticoagulant activities of Abciximab.Approved
Protein S humanAbciximab may increase the anticoagulant activities of Protein S human.Approved
PTC299PTC299 may increase the anticoagulant activities of Abciximab.Investigational
QuinestrolQuinestrol may decrease the anticoagulant activities of Abciximab.Approved
ResveratrolResveratrol may increase the anticoagulant activities of Abciximab.Experimental, Investigational
ReteplaseReteplase may increase the anticoagulant activities of Abciximab.Approved
ReviparinAbciximab may increase the anticoagulant activities of Reviparin.Approved
RidogrelRidogrel may increase the anticoagulant activities of Abciximab.Approved
RindopepimutThe therapeutic efficacy of CDX-110 can be decreased when used in combination with Abciximab.Investigational
RivaroxabanAbciximab may increase the anticoagulant activities of Rivaroxaban.Approved
RofecoxibRofecoxib may increase the anticoagulant activities of Abciximab.Investigational, Withdrawn
RosiglitazoneRosiglitazone may increase the anticoagulant activities of Abciximab.Approved, Investigational
SalicylamideSalicylamide may increase the anticoagulant activities of Abciximab.Approved
Salicylic acidThe risk or severity of adverse effects can be increased when Abciximab is combined with Salicylic acid.Approved, Vet Approved
SalsalateSalsalate may increase the anticoagulant activities of Abciximab.Approved
SCH-530348SCH-530348 may increase the anticoagulant activities of Abciximab.Investigational
SelexipagSelexipag may increase the anticoagulant activities of Abciximab.Approved
SevofluraneSevoflurane may increase the anticoagulant activities of Abciximab.Approved, Vet Approved
SRP 299The therapeutic efficacy of SRP 299 can be decreased when used in combination with Abciximab.Investigational
SRT501SRT501 may increase the anticoagulant activities of Abciximab.Investigational
StreptokinaseStreptokinase may increase the anticoagulant activities of Abciximab.Approved
SugammadexSugammadex may increase the anticoagulant activities of Abciximab.Approved
SulfasalazineSulfasalazine may increase the anticoagulant activities of Abciximab.Approved
SulindacSulindac may increase the anticoagulant activities of Abciximab.Approved
SulodexideAbciximab may increase the anticoagulant activities of Sulodexide.Approved, Investigational
SuprofenSuprofen may increase the anticoagulant activities of Abciximab.Approved, Withdrawn
Synthetic Conjugated Estrogens, ASynthetic Conjugated Estrogens, A may decrease the anticoagulant activities of Abciximab.Approved
Synthetic Conjugated Estrogens, BSynthetic Conjugated Estrogens, B may decrease the anticoagulant activities of Abciximab.Approved
TenecteplaseTenecteplase may increase the anticoagulant activities of Abciximab.Approved
TenoxicamTenoxicam may increase the anticoagulant activities of Abciximab.Approved
TeriflunomideTeriflunomide may increase the anticoagulant activities of Abciximab.Approved
TesmilifeneTesmilifene may increase the anticoagulant activities of Abciximab.Investigational
Tiaprofenic acidTiaprofenic acid may increase the anticoagulant activities of Abciximab.Approved
TiboloneTibolone may increase the anticoagulant activities of Abciximab.Approved
TicagrelorTicagrelor may increase the anticoagulant activities of Abciximab.Approved
TiclopidineTiclopidine may increase the anticoagulant activities of Abciximab.Approved
TinzaparinTinzaparin may increase the anticoagulant activities of Abciximab.Approved
TipranavirTipranavir may increase the anticoagulant activities of Abciximab.Approved, Investigational
TirofibanTirofiban may increase the anticoagulant activities of Abciximab.Approved
Tolfenamic AcidTolfenamic Acid may increase the anticoagulant activities of Abciximab.Approved
TolmetinTolmetin may increase the anticoagulant activities of Abciximab.Approved
TositumomabThe risk or severity of adverse effects can be increased when Abciximab is combined with Tositumomab.Approved
TranilastTranilast may increase the anticoagulant activities of Abciximab.Approved, Investigational
TrapidilTrapidil may increase the anticoagulant activities of Abciximab.Approved
TreprostinilTreprostinil may increase the antiplatelet activities of Abciximab.Approved, Investigational
TriflusalTriflusal may increase the anticoagulant activities of Abciximab.Approved
Trisalicylate-cholineTrisalicylate-choline may increase the anticoagulant activities of Abciximab.Approved
UrokinaseUrokinase may increase the anticoagulant activities of Abciximab.Approved, Investigational, Withdrawn
ValdecoxibValdecoxib may increase the anticoagulant activities of Abciximab.Investigational, Withdrawn
Vitamin EVitamin E may increase the anticoagulant activities of Abciximab.Approved, Nutraceutical, Vet Approved
VorapaxarThe risk or severity of adverse effects can be increased when Vorapaxar is combined with Abciximab.Approved
WarfarinAbciximab may increase the anticoagulant activities of Warfarin.Approved
XimelagatranAbciximab may increase the anticoagulant activities of Ximelagatran.Approved, Investigational, Withdrawn
ZaltoprofenZaltoprofen may increase the anticoagulant activities of Abciximab.Approved
ZileutonZileuton may increase the anticoagulant activities of Abciximab.Approved, Investigational, Withdrawn
ZomepiracZomepirac may increase the anticoagulant activities of Abciximab.Withdrawn
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Authors unspecified: Use of a monoclonal antibody directed against the platelet glycoprotein IIb/IIIa receptor in high-risk coronary angioplasty. The EPIC Investigation. N Engl J Med. 1994 Apr 7;330(14):956-61. [PubMed:8121459 ]
  2. Tcheng JE, Kandzari DE, Grines CL, Cox DA, Effron MB, Garcia E, Griffin JJ, Guagliumi G, Stuckey T, Turco M, Fahy M, Lansky AJ, Mehran R, Stone GW: Benefits and risks of abciximab use in primary angioplasty for acute myocardial infarction: the Controlled Abciximab and Device Investigation to Lower Late Angioplasty Complications (CADILLAC) trial. Circulation. 2003 Sep 16;108(11):1316-23. Epub 2003 Aug 25. [PubMed:12939213 ]
External Links
ATC CodesB01AC13
AHFS Codes
  • 92:00.00
PDB Entries
FDA labelDownload (220 KB)
MSDSDownload (19.7 KB)
Clinical Trials
Clinical Trials
PhaseStatusPurposeConditionsCount
1, 2WithdrawnNot AvailableCarotid Stenosis1
2Active Not RecruitingOtherAcute Myocardial Infarction (AMI)1
2CompletedTreatmentCerebrovascular Accidents2
2CompletedTreatmentNon ST Segment Elevation Myocardial Infarction (NSTEMI) / Stable Angina (Associated With High Risk PCI) / Unstable Angina1
2Unknown StatusPreventionPatients Above 18 Years1
2WithdrawnTreatmentHb-SS Disease With Vasoocclusive Pain / Hemoglobin SS Disease With Crisis / Hemoglobin SS Disease With Vasoocclusive Crisis / Other Sickle Cell Disease With Vaso-Occlusive Pain / Sickle Cells Disease1
2, 3Unknown StatusPreventionArterial Occlusive Diseases1
3CompletedTreatmentAngioplasty, Transluminal, Percutaneous Coronary1
3CompletedTreatmentAngioplasty, Transluminal, Percutaneous Coronary / Unstable Angina2
3CompletedTreatmentMyocardial Infarction (MI)2
3TerminatedTreatmentAcute Disease / Cerebrovascular Accidents / Ischemia, Brain1
3TerminatedTreatmentAcute Myocardial Infarction (AMI)1
3TerminatedTreatmentStenosis / Stroke1
3TerminatedTreatmentStroke1
3Unknown StatusTreatmentMyocardial Infarction (MI)1
4CompletedNot AvailableCoronary Artery Disease1
4CompletedTreatmentAcute Myocardial Infarction (AMI)2
4CompletedTreatmentAngina Pectoris / Coronary Disease1
4CompletedTreatmentCoronary Artery Disease / Ischaemia1
4CompletedTreatmentCoronary Disease / Myocardial Infarction (MI)1
4CompletedTreatmentCoronary Disease / Unstable Angina1
4CompletedTreatmentDiabetes Mellitus (DM)1
4CompletedTreatmentIschaemia / Myocardial Infarction (MI)2
4CompletedTreatmentMyocardial Infarction (MI)3
4CompletedTreatmentShock, Cardiogenic1
4TerminatedNot AvailableCoronary Disease / Myocardial Infarction (MI)1
4Unknown StatusTreatmentAngioplasty / Myocardial Infarction (MI)1
4Unknown StatusTreatmentPrimary Percutaneous Coronary Intervention / ST-Elevation Myocardial Infarction1
4Unknown StatusTreatmentST-Elevation Myocardial Infarction1
Not AvailableCompletedTreatmentAtherosclerosis / Ischemic Heart Diseases1
Not AvailableCompletedTreatmentStable Angina (SA)1
Not AvailableUnknown StatusTreatmentCoronary Artery Disease / Myocardial Infarction (MI)1
Not AvailableUnknown StatusTreatmentST-Elevation Myocardial Infarction1
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Injection, solutionIntravenous2 mg/mL
SolutionIntravenous2 mg
Prices
Unit descriptionCostUnit
Reopro 2 mg/ml vial155.77USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1341357 No2002-05-072019-05-07Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.424Not Available
isoelectric point6.16Not Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
antagonist
General Function:
Virus receptor activity
Specific Function:
Integrin alpha-V/beta-3 (ITGAV:ITGB3) is a receptor for cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin and von Willebrand factor. Integrin alpha-IIb/beta-3 (ITGA2B:ITGB3) is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. Integrins alpha-IIb/beta-3 and alpha-V/bet...
Gene Name:
ITGB3
Uniprot ID:
P05106
Molecular Weight:
87056.975 Da
References
  1. Amoroso G, van Boven AJ, van Veldhuisen DJ, Tio RA, Balje-Volkers CP, Petronio AS, van Oeveren W: Eptifibatide and abciximab exhibit equivalent antiplatelet efficacy in an experimental model of stenting in both healthy volunteers and patients with coronary artery disease. J Cardiovasc Pharmacol. 2001 Oct;38(4):633-41. [PubMed:11588534 ]
  2. Weber AA, Meila D, Jacobs C, Weber S, Kelm M, Strauer BE, Zotz RB, Scharf RE, Schror K: Low incidence of paradoxical platelet activation by glycoprotein IIb/IIIa inhibitors. Thromb Res. 2002 Apr 1;106(1):25-9. [PubMed:12165285 ]
  3. Hall PR, Malone L, Sillerud LO, Ye C, Hjelle BL, Larson RS: Characterization and NMR solution structure of a novel cyclic pentapeptide inhibitor of pathogenic hantaviruses. Chem Biol Drug Des. 2007 Mar;69(3):180-90. [PubMed:17441904 ]
  4. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
  5. Mazzaferri EL Jr, Young JJ: Abciximab: a review and update for clinicians. Expert Rev Cardiovasc Ther. 2008 Jun;6(5):609-18. doi: 10.1586/14779072.6.5.609. [PubMed:18510478 ]
  6. Ibbotson T, McGavin JK, Goa KL: Abciximab: an updated review of its therapeutic use in patients with ischaemic heart disease undergoing percutaneous coronary revascularisation. Drugs. 2003;63(11):1121-63. [PubMed:12749745 ]
Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
antagonist
General Function:
Metal ion binding
Specific Function:
Integrin alpha-IIb/beta-3 is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. It recognizes the sequence R-G-D in a wide array of ligands. It recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha-IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. ...
Gene Name:
ITGA2B
Uniprot ID:
P08514
Molecular Weight:
113375.96 Da
References
  1. Gibbs NM: Point-of-care assessment of antiplatelet agents in the perioperative period: a review. Anaesth Intensive Care. 2009 May;37(3):354-69. [PubMed:19499855 ]
  2. Mazzaferri EL Jr, Young JJ: Abciximab: a review and update for clinicians. Expert Rev Cardiovasc Ther. 2008 Jun;6(5):609-18. doi: 10.1586/14779072.6.5.609. [PubMed:18510478 ]
  3. Ibbotson T, McGavin JK, Goa KL: Abciximab: an updated review of its therapeutic use in patients with ischaemic heart disease undergoing percutaneous coronary revascularisation. Drugs. 2003;63(11):1121-63. [PubMed:12749745 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Gene Name:
FCGR3B
Uniprot ID:
O75015
Molecular Weight:
26215.64 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type peptidase activity
Specific Function:
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name:
C1R
Uniprot ID:
P00736
Molecular Weight:
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QA
Uniprot ID:
P02745
Molecular Weight:
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QB
Uniprot ID:
P02746
Molecular Weight:
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QC
Uniprot ID:
P02747
Molecular Weight:
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
Gene Name:
FCGR3A
Uniprot ID:
P08637
Molecular Weight:
29088.895 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type endopeptidase activity
Specific Function:
C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activate C2 and C4.
Gene Name:
C1S
Uniprot ID:
P09871
Molecular Weight:
76683.905 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Receptor signaling protein activity
Specific Function:
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name:
FCGR1A
Uniprot ID:
P12314
Molecular Weight:
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.
Gene Name:
FCGR2A
Uniprot ID:
P12318
Molecular Weight:
35000.42 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells ...
Gene Name:
FCGR2B
Uniprot ID:
P31994
Molecular Weight:
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Transmembrane signaling receptor activity
Specific Function:
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.
Gene Name:
FCGR2C
Uniprot ID:
P31995
Molecular Weight:
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Scavenger receptor activity
Specific Function:
Vitronectin is a cell adhesion and spreading factor found in serum and tissues. Vitronectin interact with glycosaminoglycans and proteoglycans. Is recognized by certain members of the integrin family and serves as a cell-to-substrate adhesion molecule. Inhibitor of the membrane-damaging effect of the terminal cytolytic complement pathway.Somatomedin-B is a growth hormone-dependent serum factor ...
Gene Name:
VTN
Uniprot ID:
P04004
Molecular Weight:
54305.135 Da
References
  1. Romagnoli E, Burzotta F, Trani C, Biondi-Zoccai GG, Giannico F, Crea F: Rationale for intracoronary administration of abciximab. J Thromb Thrombolysis. 2007 Feb;23(1):57-63. [PubMed:17160551 ]
  2. Ibbotson T, McGavin JK, Goa KL: Abciximab: an updated review of its therapeutic use in patients with ischaemic heart disease undergoing percutaneous coronary revascularisation. Drugs. 2003;63(11):1121-63. [PubMed:12749745 ]
Drug created on June 13, 2005 07:24 / Updated on April 27, 2017 13:58