Identification

Name
Abciximab
Accession Number
DB00054  (BTD00041, BIOD00041)
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Abciximab is a Fab fragment of the chimeric human-murine monoclonal antibody 7E3. Abciximab binds to the glycoprotein (GP) IIb/IIIa receptor of human platelets and inhibits platelet aggregation by preventing the binding of fibrinogen, von Willebrand factor, and other adhesive molecules. It also binds to vitronectin (αvβ3) receptor found on platelets and vessel wall endothelial and smooth muscle cells.

Protein structure
Db00054
Protein chemical formula
C6462H9964N1690O2049S48
Protein average weight
145651.1 Da
Sequences
>1TXV:H ReoPro-like antibody Heavy Chain 1
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKY
DPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSA
KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE
LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>1TXV:L ReoPro-like antibody Light Chain 1
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPS
RFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>1TXV:H ReoPro-like antibody Heavy Chain 2
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKY
DPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSA
KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE
LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>1TXV:L ReoPro-like antibody Light Chain 2
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPS
RFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Download FASTA Format
Synonyms
  • 7E3
  • 7E3 antibody
  • Abciximab (genetical recombination)
  • antiGPIIBIIIa
  • c7E3
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
ReoproInjection, solution2 mg/mLIntravenousJanssen Biotech, Inc.2017-01-03Not applicableUs
ReoproInjection, solution2 mg/mLIntravenousEli Lilly & Co. Ltd.1993-12-16Not applicableUs
ReoproSolution2 mgIntravenousJanssen Pharmaceuticals1996-10-30Not applicableCanada
Categories
UNII
X85G7936GV
CAS number
143653-53-6

Pharmacology

Indication

Abciximab is indicated as an adjunct to percutaneous coronary intervention for the prevention of cardiac ischemic complications in patients undergoing percutaneous coronary intervention and in patients with unstable angina not responding to conventional medical therapy when percutaneous coronary intervention is planned within 24 hours. Abciximab is intended for use with aspirin and heparin and has been studied only in that setting.

Associated Conditions
Pharmacodynamics

Abciximab inhibits platelet aggregation by preventing the binding of fibrinogen, von Willebrand factor, and other adhesive molecules to GPIIb/IIIa receptor sites on activated platelets. A single intravenous bolus dose from 0.15 mg/kg to 0.30 mg/kg produced rapid dose-dependent inhibition of platelet function. After two hours post-injection with a dose of 0.25 - 0.30 mg/kg, 80% of the GPIIb/IIIa receptors were blocked and platelet aggregation was prevented. GPIIb/IIIa is the major surface receptor involved in the final pathway of platelet aggregation. Bleeding time increases to over 30 minutes at the aforementioned doses. To compare, baseline values were five minutes.

Mechanism of action

Abciximab binds to the intact platelet GPIIb/IIIa receptor, which is a member of the integrin family of adhesion receptors and the major platelet surface receptor involved in platelet aggregation. This binding is thought to involve steric hindrance and/or conformational alterations which block access of large molecules to the receptor rather than direct interaction with the RGD (arginine-glycine-aspartic acid) binding site of GPIIb/IIIa. By binding to the vitronectin receptor (also known as the αvβ3 integrin), abciximab blocks effects mediated by this integrin which include cell adhesion. Furthermore, abciximab blocks Mac-1 receptor on monocytes and neutrophils thus inhibiting monocyte adhesion.

TargetActionsOrganism
AIntegrin beta-3
antagonist
Human
AIntegrin alpha-IIb
antagonist
Human
ULow affinity immunoglobulin gamma Fc region receptor III-BNot AvailableHuman
UComplement C1r subcomponentNot AvailableHuman
UComplement C1q subcomponent subunit ANot AvailableHuman
UComplement C1q subcomponent subunit BNot AvailableHuman
UComplement C1q subcomponent subunit CNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor III-ANot AvailableHuman
UComplement C1s subcomponentNot AvailableHuman
UHigh affinity immunoglobulin gamma Fc receptor INot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-aNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-bNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-cNot AvailableHuman
UVitronectinNot AvailableHuman
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system when bound to platelets, or by human antimurine antibody production. Excreted renally.

Route of elimination
Not Available
Half life

Following intravenous bolus administration, free plasma concentrations of Abciximab decrease rapidly with an initial half-life of less than 10 minutes and a second phase half-life of about 30 minutes, probably related to rapid binding to the platelet GPIIb/IIIa receptors.

Clearance
Not Available
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
PathwayCategory
Abciximab Action PathwayDrug action
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
(R)-warfarinThe risk or severity of bleeding can be increased when Abciximab is combined with (R)-warfarin.Experimental
(S)-WarfarinThe risk or severity of bleeding can be increased when Abciximab is combined with (S)-Warfarin.Experimental, Investigational
4-hydroxycoumarinThe risk or severity of bleeding can be increased when Abciximab is combined with 4-hydroxycoumarin.Experimental
AbituzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Abituzumab.Investigational
AceclofenacThe risk or severity of bleeding and hemorrhage can be increased when Aceclofenac is combined with Abciximab.Approved, Investigational
AcenocoumarolThe risk or severity of bleeding can be increased when Abciximab is combined with Acenocoumarol.Approved, Investigational
Acetylsalicylic acidThe risk or severity of bleeding can be increased when Acetylsalicylic acid is combined with Abciximab.Approved, Vet Approved
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Abciximab.Approved
AdecatumumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Adecatumumab.Investigational
AducanumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Aducanumab.Investigational
AfelimomabThe risk or severity of adverse effects can be increased when Abciximab is combined with Afelimomab.Investigational
AlaproclateAlaproclate may increase the antiplatelet activities of Abciximab.Experimental
AlclofenacThe risk or severity of bleeding and hemorrhage can be increased when Alclofenac is combined with Abciximab.Approved, Withdrawn
AlemtuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Alemtuzumab.Approved, Investigational
AlirocumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Alirocumab.Approved
AllylestrenolAllylestrenol may decrease the anticoagulant activities of Abciximab.Approved
AlminoprofenThe risk or severity of bleeding and hemorrhage can be increased when Alminoprofen is combined with Abciximab.Experimental
AloxiprinThe risk or severity of bleeding can be increased when Aloxiprin is combined with Abciximab.Experimental
AlteplaseThe risk or severity of bleeding can be increased when Alteplase is combined with Abciximab.Approved
AltrenogestAltrenogest may decrease the anticoagulant activities of Abciximab.Vet Approved
AmatuximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Amatuximab.Investigational
AmediplaseThe risk or severity of bleeding can be increased when Abciximab is combined with Amediplase.Investigational
AMG 108The risk or severity of adverse effects can be increased when Abciximab is combined with AMG 108.Investigational
AminophenazoneThe risk or severity of bleeding and hemorrhage can be increased when Aminophenazone is combined with Abciximab.Approved, Withdrawn
Aminosalicylic AcidThe risk or severity of bleeding can be increased when Aminosalicylic Acid is combined with Abciximab.Approved
AnagrelideThe risk or severity of bleeding can be increased when Anagrelide is combined with Abciximab.Approved
AncrodThe risk or severity of bleeding can be increased when Ancrod is combined with Abciximab.Approved, Investigational
Andexanet alfaThe therapeutic efficacy of Andexanet alfa can be decreased when used in combination with Abciximab.Approved, Investigational
AndrographolideAndrographolide may increase the anticoagulant activities of Abciximab.Investigational
AnifrolumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Anifrolumab.Investigational
AnistreplaseThe risk or severity of bleeding can be increased when Anistreplase is combined with Abciximab.Approved
Anti-inhibitor coagulant complexThe therapeutic efficacy of Anti-inhibitor coagulant complex can be decreased when used in combination with Abciximab.Approved, Investigational
Antihemophilic factor humanThe therapeutic efficacy of Antihemophilic factor human can be decreased when used in combination with Abciximab.Approved
Antihemophilic factor, human recombinantThe therapeutic efficacy of Antihemophilic factor, human recombinant can be decreased when used in combination with Abciximab.Approved, Investigational
Antilymphocyte immunoglobulin (horse)The risk or severity of adverse effects can be increased when Abciximab is combined with Antilymphocyte immunoglobulin (horse).Approved, Investigational
AntipyrineThe risk or severity of bleeding and hemorrhage can be increased when Antipyrine is combined with Abciximab.Approved, Investigational
Antithrombin III humanThe risk or severity of bleeding can be increased when Abciximab is combined with Antithrombin III human.Approved
Antithymocyte immunoglobulin (rabbit)The risk or severity of adverse effects can be increased when Abciximab is combined with Antithymocyte immunoglobulin (rabbit).Approved
AntrafenineThe risk or severity of bleeding and hemorrhage can be increased when Antrafenine is combined with Abciximab.Approved
ApixabanApixaban may increase the anticoagulant activities of Abciximab.Approved
ApolizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Apolizumab.Investigational
AprotininThe therapeutic efficacy of Abciximab can be decreased when used in combination with Aprotinin.Approved, Investigational, Withdrawn
ArdeparinThe risk or severity of bleeding can be increased when Abciximab is combined with Ardeparin.Approved, Investigational, Withdrawn
ArgatrobanThe risk or severity of bleeding can be increased when Abciximab is combined with Argatroban.Approved, Investigational
AscrinvacumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Ascrinvacumab.Investigational
Asfotase AlfaThe risk or severity of adverse effects can be increased when Abciximab is combined with Asfotase Alfa.Approved, Investigational
AstaxanthinThe risk or severity of bleeding can be increased when Astaxanthin is combined with Abciximab.Investigational
AtezolizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Atezolizumab.Approved, Investigational
AVE9633The risk or severity of adverse effects can be increased when Abciximab is combined with AVE9633.Investigational
AvelumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Avelumab.Approved, Investigational
AzapropazoneThe risk or severity of bleeding and hemorrhage can be increased when Azapropazone is combined with Abciximab.Withdrawn
Azficel-TThe risk or severity of adverse effects can be increased when Abciximab is combined with Azficel-T.Approved, Investigational
BalsalazideThe risk or severity of bleeding can be increased when Balsalazide is combined with Abciximab.Approved, Investigational
BapineuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Bapineuzumab.Investigational
BasiliximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Basiliximab.Approved, Investigational
BavituximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Bavituximab.Investigational
BectumomabThe risk or severity of adverse effects can be increased when Abciximab is combined with Bectumomab.Investigational
BelimumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Belimumab.Approved
BemiparinThe risk or severity of bleeding can be increased when Abciximab is combined with Bemiparin.Approved, Investigational
BendazacThe risk or severity of bleeding and hemorrhage can be increased when Bendazac is combined with Abciximab.Experimental
BenorilateThe risk or severity of bleeding and hemorrhage can be increased when Benorilate is combined with Abciximab.Experimental
BenoxaprofenThe risk or severity of bleeding and hemorrhage can be increased when Benoxaprofen is combined with Abciximab.Withdrawn
BenzydamineThe risk or severity of bleeding and hemorrhage can be increased when Benzydamine is combined with Abciximab.Approved
BeraprostThe risk or severity of bleeding can be increased when Abciximab is combined with Beraprost.Investigational
Beroctocog alfaThe therapeutic efficacy of Beroctocog alfa can be decreased when used in combination with Abciximab.Approved, Investigational
BesilesomabThe risk or severity of adverse effects can be increased when Abciximab is combined with Besilesomab.Approved
BevacizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Bevacizumab.Approved, Investigational
BIIB015The risk or severity of adverse effects can be increased when Abciximab is combined with BIIB015.Investigational
BimagrumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Bimagrumab.Investigational
BivalirudinThe risk or severity of bleeding can be increased when Abciximab is combined with Bivalirudin.Approved, Investigational
BivatuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Bivatuzumab.Investigational
BlinatumomabThe risk or severity of adverse effects can be increased when Abciximab is combined with Blinatumomab.Approved, Investigational
BlosozumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Blosozumab.Investigational
BococizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Bococizumab.Investigational
Brentuximab vedotinThe risk or severity of adverse effects can be increased when Abciximab is combined with Brentuximab vedotin.Approved, Investigational
BriakinumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Briakinumab.Investigational
BrinaseThe risk or severity of bleeding can be increased when Brinase is combined with Abciximab.Experimental
BrodalumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Brodalumab.Approved, Investigational
BromfenacThe risk or severity of bleeding and hemorrhage can be increased when Bromfenac is combined with Abciximab.Approved
BufexamacThe risk or severity of bleeding and hemorrhage can be increased when Bufexamac is combined with Abciximab.Approved, Experimental
BuflomedilBuflomedil may increase the anticoagulant activities of Abciximab.Experimental
BumadizoneThe risk or severity of bleeding and hemorrhage can be increased when Bumadizone is combined with Abciximab.Experimental
ButylphthalideButylphthalide may increase the anticoagulant activities of Abciximab.Investigational
CanakinumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Canakinumab.Approved, Investigational
CangrelorThe risk or severity of bleeding can be increased when Abciximab is combined with Cangrelor.Approved
CaplacizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Caplacizumab.Investigational
Capromab pendetideThe risk or severity of adverse effects can be increased when Abciximab is combined with Capromab pendetide.Approved
Carbaspirin calciumThe risk or severity of bleeding can be increased when Carbaspirin calcium is combined with Abciximab.Experimental, Investigational
CarlumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Carlumab.Investigational
CarprofenThe risk or severity of bleeding and hemorrhage can be increased when Carprofen is combined with Abciximab.Approved, Vet Approved, Withdrawn
CatumaxomabThe risk or severity of adverse effects can be increased when Abciximab is combined with Catumaxomab.Approved, Investigational, Withdrawn
CelecoxibThe risk or severity of bleeding and hemorrhage can be increased when Celecoxib is combined with Abciximab.Approved, Investigational
Certolizumab pegolThe risk or severity of adverse effects can be increased when Abciximab is combined with Certolizumab pegol.Approved
CertoparinThe risk or severity of bleeding can be increased when Abciximab is combined with Certoparin.Approved, Investigational
CetuximabThe risk or severity of adverse effects can be increased when Cetuximab is combined with Abciximab.Approved
ChlormadinoneChlormadinone may decrease the anticoagulant activities of Abciximab.Experimental
ChlorotrianiseneChlorotrianisene may decrease the anticoagulant activities of Abciximab.Investigational, Withdrawn
Choline magnesium trisalicylateThe risk or severity of bleeding and hemorrhage can be increased when Choline magnesium trisalicylate is combined with Abciximab.Approved
CilostazolCilostazol may increase the anticoagulant activities of Abciximab.Approved, Investigational
CimicoxibThe risk or severity of bleeding and hemorrhage can be increased when Cimicoxib is combined with Abciximab.Investigational
CitalopramCitalopram may increase the antiplatelet activities of Abciximab.Approved
CixutumumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Cixutumumab.Investigational
ClazakizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Clazakizumab.Investigational
ClenoliximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Clenoliximab.Investigational
ClonixinThe risk or severity of bleeding and hemorrhage can be increased when Clonixin is combined with Abciximab.Approved
ClopidogrelClopidogrel may increase the anticoagulant activities of Abciximab.Approved
CloricromenCloricromen may increase the anticoagulant activities of Abciximab.Experimental
ClorindioneThe risk or severity of bleeding can be increased when Abciximab is combined with Clorindione.Experimental
Coagulation Factor IX (Recombinant)The therapeutic efficacy of Coagulation Factor IX (Recombinant) can be decreased when used in combination with Abciximab.Approved, Investigational
Coagulation factor VII humanThe therapeutic efficacy of Coagulation factor VII human can be decreased when used in combination with Abciximab.Approved, Investigational
Coagulation factor VIIa Recombinant HumanThe therapeutic efficacy of Coagulation factor VIIa Recombinant Human can be decreased when used in combination with Abciximab.Approved
Coagulation factor X humanThe therapeutic efficacy of Coagulation factor X human can be decreased when used in combination with Abciximab.Approved, Investigational
Coagulation Factor XIII A-Subunit (Recombinant)The therapeutic efficacy of Coagulation Factor XIII A-Subunit (Recombinant) can be decreased when used in combination with Abciximab.Approved
Collagenase clostridium histolyticumThe risk or severity of adverse effects can be increased when Abciximab is combined with Collagenase clostridium histolyticum.Approved, Investigational
Collagenase clostridium histolyticumThe risk or severity of bleeding and hemorrhage can be increased when Abciximab is combined with Collagenase clostridium histolyticum.Approved, Investigational
Coltuximab ravtansineThe risk or severity of adverse effects can be increased when Abciximab is combined with Coltuximab ravtansine.Investigational
ConatumumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Conatumumab.Investigational
ConcizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Concizumab.Investigational
Conjugated estrogensConjugated estrogens may decrease the anticoagulant activities of Abciximab.Approved
CR002The risk or severity of adverse effects can be increased when Abciximab is combined with CR002.Investigational
CrenezumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Crenezumab.Investigational
CrotedumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Crotedumab.Investigational
Cyproterone acetateCyproterone acetate may decrease the anticoagulant activities of Abciximab.Approved, Investigational
Dabigatran etexilateDabigatran etexilate may increase the anticoagulant activities of Abciximab.Approved
DacetuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Dacetuzumab.Investigational
DaclizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Daclizumab.Investigational, Withdrawn
DalotuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Dalotuzumab.Investigational
DalteparinThe risk or severity of bleeding can be increased when Dalteparin is combined with Abciximab.Approved
DanaparoidThe risk or severity of bleeding can be increased when Danaparoid is combined with Abciximab.Approved, Withdrawn
DapoxetineDapoxetine may increase the antiplatelet activities of Abciximab.Investigational
DaratumumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Daratumumab.Approved
DarexabanThe risk or severity of bleeding can be increased when Abciximab is combined with Darexaban.Investigational
DasatinibThe risk or severity of bleeding and hemorrhage can be increased when Dasatinib is combined with Abciximab.Approved, Investigational
DeferasiroxThe risk or severity of gastrointestinal bleeding can be increased when Abciximab is combined with Deferasirox.Approved, Investigational
DefibrotideThe risk or severity of bleeding can be increased when Defibrotide is combined with Abciximab.Approved, Investigational
DemcizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Demcizumab.Investigational
DemegestoneDemegestone may decrease the anticoagulant activities of Abciximab.Approved
DenosumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Denosumab.Approved
Deoxycholic AcidThe risk or severity of adverse effects can be increased when Abciximab is combined with Deoxycholic Acid.Approved
Deoxycholic AcidThe risk or severity of bleeding and bruising can be increased when Abciximab is combined with Deoxycholic Acid.Approved
DepatuxizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Depatuxizumab.Investigational
Depatuxizumab mafodotinThe risk or severity of adverse effects can be increased when Abciximab is combined with Depatuxizumab mafodotin.Investigational
DersalazineThe risk or severity of bleeding can be increased when Dersalazine is combined with Abciximab.Investigational
DesirudinThe risk or severity of bleeding can be increased when Abciximab is combined with Desirudin.Approved
DesmoteplaseThe risk or severity of bleeding can be increased when Desmoteplase is combined with Abciximab.Investigational
DesogestrelDesogestrel may decrease the anticoagulant activities of Abciximab.Approved
DesvenlafaxineDesvenlafaxine may increase the antiplatelet activities of Abciximab.Approved, Investigational
DexibuprofenThe risk or severity of bleeding and hemorrhage can be increased when Dexibuprofen is combined with Abciximab.Approved, Investigational
DexketoprofenThe risk or severity of bleeding and hemorrhage can be increased when Dexketoprofen is combined with Abciximab.Approved, Investigational
DextranDextran may increase the anticoagulant activities of Abciximab.Approved, Investigational, Vet Approved
DiclofenacThe risk or severity of bleeding and hemorrhage can be increased when Diclofenac is combined with Abciximab.Approved, Vet Approved
DicoumarolThe risk or severity of bleeding can be increased when Abciximab is combined with Dicoumarol.Approved
DienestrolDienestrol may decrease the anticoagulant activities of Abciximab.Approved, Investigational
DienogestDienogest may decrease the anticoagulant activities of Abciximab.Approved
DiethylstilbestrolDiethylstilbestrol may decrease the anticoagulant activities of Abciximab.Approved, Investigational
DifenpiramideThe risk or severity of bleeding and hemorrhage can be increased when Difenpiramide is combined with Abciximab.Experimental
DiflunisalThe risk or severity of bleeding can be increased when Diflunisal is combined with Abciximab.Approved, Investigational
Digoxin Immune Fab (Ovine)The risk or severity of adverse effects can be increased when Abciximab is combined with Digoxin Immune Fab (Ovine).Approved
DinutuximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Dinutuximab.Approved, Investigational
DiphenadioneThe risk or severity of bleeding can be increased when Abciximab is combined with Diphenadione.Experimental
DipyridamoleThe risk or severity of bleeding can be increased when Abciximab is combined with Dipyridamole.Approved
DitazoleThe risk or severity of bleeding can be increased when Abciximab is combined with Ditazole.Approved, Withdrawn
DrospirenoneDrospirenone may decrease the anticoagulant activities of Abciximab.Approved
Drotrecogin alfaThe risk or severity of bleeding can be increased when Drotrecogin alfa is combined with Abciximab.Approved, Investigational, Withdrawn
DroxicamThe risk or severity of bleeding and hemorrhage can be increased when Droxicam is combined with Abciximab.Withdrawn
DulaglutideThe risk or severity of adverse effects can be increased when Abciximab is combined with Dulaglutide.Approved, Investigational
DuligotuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Duligotuzumab.Investigational
DuloxetineDuloxetine may increase the antiplatelet activities of Abciximab.Approved
DupilumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Dupilumab.Approved, Investigational
DurvalumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Durvalumab.Approved, Investigational
DusigitumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Dusigitumab.Investigational
DydrogesteroneDydrogesterone may decrease the anticoagulant activities of Abciximab.Approved, Investigational, Withdrawn
EculizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Eculizumab.Approved, Investigational
Edetic AcidThe risk or severity of bleeding can be increased when Abciximab is combined with Edetic Acid.Approved, Vet Approved
EdoxabanThe risk or severity of bleeding can be increased when Edoxaban is combined with Abciximab.Approved
EdrecolomabThe risk or severity of adverse effects can be increased when Abciximab is combined with Edrecolomab.Experimental, Investigational
EfalizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Efalizumab.Approved, Investigational
EldelumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Eldelumab.Investigational
ElotuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Elotuzumab.Approved
EmibetuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Emibetuzumab.Investigational
EmicizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Emicizumab.Approved, Investigational
EnokizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Enokizumab.Investigational
EnoxaparinThe risk or severity of bleeding can be increased when Abciximab is combined with Enoxaparin.Approved
EpimestrolEpimestrol may decrease the anticoagulant activities of Abciximab.Experimental
EpirizoleThe risk or severity of bleeding and hemorrhage can be increased when Epirizole is combined with Abciximab.Approved
EpoprostenolThe risk or severity of bleeding can be increased when Abciximab is combined with Epoprostenol.Approved
EpratuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Epratuzumab.Investigational
EptifibatideEptifibatide may increase the anticoagulant activities of Abciximab.Approved, Investigational
EquolEquol may decrease the anticoagulant activities of Abciximab.Investigational
ErenumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Erenumab.Approved, Investigational
EscitalopramEscitalopram may increase the antiplatelet activities of Abciximab.Approved, Investigational
EstradiolEstradiol may decrease the anticoagulant activities of Abciximab.Approved, Investigational, Vet Approved
Estradiol acetateEstradiol acetate may decrease the anticoagulant activities of Abciximab.Approved, Investigational, Vet Approved
Estradiol benzoateEstradiol benzoate may decrease the anticoagulant activities of Abciximab.Approved, Investigational, Vet Approved
Estradiol cypionateEstradiol cypionate may decrease the anticoagulant activities of Abciximab.Approved, Investigational, Vet Approved
Estradiol valerateEstradiol valerate may decrease the anticoagulant activities of Abciximab.Approved, Investigational, Vet Approved
EstriolEstriol may decrease the anticoagulant activities of Abciximab.Approved, Investigational, Vet Approved
Estrogens, esterifiedEstrogens, esterified may decrease the anticoagulant activities of Abciximab.Approved
EstroneEstrone may decrease the anticoagulant activities of Abciximab.Approved
Estrone sulfateEstrone sulfate may decrease the anticoagulant activities of Abciximab.Approved
EtaracizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Etaracizumab.Investigational
EthenzamideThe risk or severity of bleeding and hemorrhage can be increased when Ethenzamide is combined with Abciximab.Experimental
Ethinyl EstradiolEthinyl Estradiol may decrease the anticoagulant activities of Abciximab.Approved
Ethyl biscoumacetateThe risk or severity of bleeding can be increased when Abciximab is combined with Ethyl biscoumacetate.Withdrawn
EthynodiolEthynodiol may decrease the anticoagulant activities of Abciximab.Experimental
Ethynodiol diacetateEthynodiol diacetate may decrease the anticoagulant activities of Abciximab.Approved
EtodolacThe risk or severity of bleeding and hemorrhage can be increased when Etodolac is combined with Abciximab.Approved, Investigational, Vet Approved
EtofenamateThe risk or severity of bleeding and hemorrhage can be increased when Etofenamate is combined with Abciximab.Approved, Investigational
EtonogestrelEtonogestrel may decrease the anticoagulant activities of Abciximab.Approved, Investigational
EtoricoxibThe risk or severity of bleeding and hemorrhage can be increased when Etoricoxib is combined with Abciximab.Approved, Investigational
EtrolizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Etrolizumab.Investigational
EvolocumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Evolocumab.Approved
Factor IX Complex (Human)The therapeutic efficacy of Factor IX Complex (Human) can be decreased when used in combination with Abciximab.Approved, Investigational
Factor XIII (human)The therapeutic efficacy of Factor XIII (human) can be decreased when used in combination with Abciximab.Approved, Investigational
FanolesomabThe risk or severity of adverse effects can be increased when Abciximab is combined with Fanolesomab.Experimental
FarletuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Farletuzumab.Investigational
FelbinacThe risk or severity of bleeding and hemorrhage can be increased when Felbinac is combined with Abciximab.Experimental
FenbufenThe risk or severity of bleeding and hemorrhage can be increased when Fenbufen is combined with Abciximab.Approved
FenoprofenThe risk or severity of bleeding and hemorrhage can be increased when Fenoprofen is combined with Abciximab.Approved
FentiazacThe risk or severity of bleeding and hemorrhage can be increased when Fentiazac is combined with Abciximab.Experimental
FeprazoneThe risk or severity of bleeding and hemorrhage can be increased when Feprazone is combined with Abciximab.Experimental
Ferulic acidThe risk or severity of bleeding can be increased when Abciximab is combined with Ferulic acid.Experimental
Fibrinogen HumanThe therapeutic efficacy of Fibrinogen Human can be decreased when used in combination with Abciximab.Approved
FibrinolysinThe risk or severity of bleeding can be increased when Fibrinolysin is combined with Abciximab.Investigational
FiclatuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Ficlatuzumab.Investigational
FigitumumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Figitumumab.Investigational
FirocoxibThe risk or severity of bleeding and hemorrhage can be increased when Firocoxib is combined with Abciximab.Experimental, Vet Approved
FloctafenineThe risk or severity of bleeding and hemorrhage can be increased when Floctafenine is combined with Abciximab.Approved, Withdrawn
FluindioneThe risk or severity of bleeding can be increased when Abciximab is combined with Fluindione.Approved, Investigational
FlunixinThe risk or severity of bleeding and hemorrhage can be increased when Flunixin is combined with Abciximab.Vet Approved
FlunoxaprofenThe risk or severity of bleeding and hemorrhage can be increased when Flunoxaprofen is combined with Abciximab.Experimental
FluoxetineFluoxetine may increase the antiplatelet activities of Abciximab.Approved, Vet Approved
FlurbiprofenThe risk or severity of bleeding and hemorrhage can be increased when Flurbiprofen is combined with Abciximab.Approved, Investigational
FluvoxamineFluvoxamine may increase the antiplatelet activities of Abciximab.Approved, Investigational
FondaparinuxThe risk or severity of bleeding can be increased when Abciximab is combined with Fondaparinux.Approved, Investigational
FontolizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Fontolizumab.Investigational
FremanezumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Fremanezumab.Investigational
FresolimumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Fresolimumab.Investigational
FulranumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Fulranumab.Investigational
GabexateThe risk or severity of bleeding can be increased when Abciximab is combined with Gabexate.Investigational
GaliximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Galiximab.Investigational
GanitumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Ganitumab.Investigational
GantenerumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Gantenerumab.Investigational
Gemtuzumab ozogamicinThe risk or severity of adverse effects can be increased when Abciximab is combined with Gemtuzumab ozogamicin.Approved, Investigational
GestodeneGestodene may decrease the anticoagulant activities of Abciximab.Approved, Investigational
GestonoroneGestonorone may decrease the anticoagulant activities of Abciximab.Experimental
GestrinoneGestrinone may decrease the anticoagulant activities of Abciximab.Approved
GevokizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Gevokizumab.Investigational
Glembatumumab vedotinThe risk or severity of adverse effects can be increased when Abciximab is combined with Glembatumumab vedotin.Investigational
GlucosamineGlucosamine may increase the antiplatelet activities of Abciximab.Approved, Investigational
GolimumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Golimumab.Approved
GuacetisalThe risk or severity of bleeding can be increased when Guacetisal is combined with Abciximab.Experimental
GuselkumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Guselkumab.Approved, Investigational
HeminHemin may increase the anticoagulant activities of Abciximab.Approved, Investigational
HeparinThe risk or severity of bleeding can be increased when Abciximab is combined with Heparin.Approved, Investigational
HexestrolHexestrol may decrease the anticoagulant activities of Abciximab.Withdrawn
Human cytomegalovirus immune globulinThe risk or severity of adverse effects can be increased when Abciximab is combined with Human cytomegalovirus immune globulin.Approved
Human ThrombinThe therapeutic efficacy of Human Thrombin can be decreased when used in combination with Abciximab.Approved
Human Varicella-Zoster Immune GlobulinThe risk or severity of adverse effects can be increased when Abciximab is combined with Human Varicella-Zoster Immune Globulin.Approved
HydroxyprogesteroneHydroxyprogesterone may decrease the anticoagulant activities of Abciximab.Experimental
Hydroxyprogesterone caproateHydroxyprogesterone caproate may decrease the anticoagulant activities of Abciximab.Approved, Investigational
HydroxytyrosolHydroxytyrosol may increase the anticoagulant activities of Abciximab.Investigational
IbalizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Ibalizumab.Approved, Investigational
Ibritumomab tiuxetanThe risk or severity of adverse effects can be increased when Abciximab is combined with Ibritumomab tiuxetan.Approved, Investigational
Ibritumomab tiuxetanThe risk or severity of bleeding and hemorrhage can be increased when Abciximab is combined with Ibritumomab tiuxetan.Approved, Investigational
IbrutinibThe risk or severity of adverse effects can be increased when Ibrutinib is combined with Abciximab.Approved
IbudilastIbudilast may increase the anticoagulant activities of Abciximab.Approved, Investigational
IbuprofenThe risk or severity of bleeding and hemorrhage can be increased when Ibuprofen is combined with Abciximab.Approved
IbuproxamThe risk or severity of bleeding and hemorrhage can be increased when Ibuproxam is combined with Abciximab.Withdrawn
IcosapentThe risk or severity of bleeding and hemorrhage can be increased when Icosapent is combined with Abciximab.Approved, Nutraceutical
Icosapent ethylIcosapent ethyl may increase the anticoagulant activities of Abciximab.Approved, Investigational, Nutraceutical
IdarucizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Idarucizumab.Approved
IdraparinuxThe risk or severity of bleeding can be increased when Abciximab is combined with Idraparinux.Investigational
IfetrobanIfetroban may increase the anticoagulant activities of Abciximab.Investigational
IGN311The risk or severity of adverse effects can be increased when Abciximab is combined with IGN311.Investigational
IloprostThe risk or severity of bleeding can be increased when Abciximab is combined with Iloprost.Approved, Investigational
IMC-1C11The risk or severity of adverse effects can be increased when Abciximab is combined with IMC-1C11.Investigational
Imidazole salicylateThe risk or severity of bleeding and hemorrhage can be increased when Imidazole salicylate is combined with Abciximab.Experimental
Immune Globulin HumanThe risk or severity of adverse effects can be increased when Immune Globulin Human is combined with Abciximab.Approved, Investigational
InclacumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Inclacumab.Investigational
IndalpineIndalpine may increase the antiplatelet activities of Abciximab.Investigational, Withdrawn
Indium In-111 satumomab pendetideThe risk or severity of adverse effects can be increased when Abciximab is combined with Indium In-111 satumomab pendetide.Approved, Withdrawn
IndobufenIndobufen may increase the anticoagulant activities of Abciximab.Investigational
IndomethacinThe risk or severity of bleeding and hemorrhage can be increased when Indomethacin is combined with Abciximab.Approved, Investigational
IndoprofenThe risk or severity of bleeding and hemorrhage can be increased when Indoprofen is combined with Abciximab.Withdrawn
InebilizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Inebilizumab.Investigational
InfliximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Infliximab.Approved
Inotuzumab ozogamicinThe risk or severity of adverse effects can be increased when Abciximab is combined with Inotuzumab ozogamicin.Approved, Investigational
IntetumumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Intetumumab.Investigational
IPH 2101The risk or severity of adverse effects can be increased when Abciximab is combined with IPH 2101.Investigational
IpilimumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Ipilimumab.Approved
IratumumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Iratumumab.Investigational
IsoxicamThe risk or severity of bleeding and hemorrhage can be increased when Isoxicam is combined with Abciximab.Withdrawn
IxekizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Ixekizumab.Approved, Investigational
KallidinogenaseThe therapeutic efficacy of Kallidinogenase can be decreased when used in combination with Abciximab.Experimental
KebuzoneThe risk or severity of bleeding and hemorrhage can be increased when Kebuzone is combined with Abciximab.Experimental
KetanserinKetanserin may increase the anticoagulant activities of Abciximab.Investigational
KetoprofenThe risk or severity of bleeding and hemorrhage can be increased when Ketoprofen is combined with Abciximab.Approved, Vet Approved
KetorolacThe risk or severity of bleeding and hemorrhage can be increased when Ketorolac is combined with Abciximab.Approved
LabetuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Labetuzumab.Investigational
LampalizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Lampalizumab.Investigational
LandogrozumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Landogrozumab.Investigational
LepirudinThe risk or severity of bleeding can be increased when Abciximab is combined with Lepirudin.Approved
LerdelimumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Lerdelimumab.Investigational
LetaxabanThe risk or severity of bleeding can be increased when Abciximab is combined with Letaxaban.Investigational
LevomilnacipranLevomilnacipran may increase the antiplatelet activities of Abciximab.Approved, Investigational
LevonorgestrelLevonorgestrel may decrease the anticoagulant activities of Abciximab.Approved, Investigational
LexatumumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Lexatumumab.Investigational
LigelizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Ligelizumab.Investigational
LimaprostThe risk or severity of adverse effects can be increased when Limaprost is combined with Abciximab.Approved, Investigational
LinsidomineLinsidomine may increase the anticoagulant activities of Abciximab.Experimental
LonazolacThe risk or severity of bleeding and hemorrhage can be increased when Lonazolac is combined with Abciximab.Experimental
LornoxicamThe risk or severity of bleeding and hemorrhage can be increased when Lornoxicam is combined with Abciximab.Approved, Investigational
Lorvotuzumab mertansineThe risk or severity of adverse effects can be increased when Abciximab is combined with Lorvotuzumab mertansine.Investigational
LoxoprofenThe risk or severity of bleeding and hemorrhage can be increased when Loxoprofen is combined with Abciximab.Approved, Investigational
LucatumumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Lucatumumab.Investigational
LumiliximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Lumiliximab.Investigational
LumiracoxibThe risk or severity of bleeding and hemorrhage can be increased when Lumiracoxib is combined with Abciximab.Approved, Investigational
LynestrenolLynestrenol may decrease the anticoagulant activities of Abciximab.Approved, Investigational
Magnesium salicylateThe risk or severity of bleeding and hemorrhage can be increased when Magnesium salicylate is combined with Abciximab.Approved
MatuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Matuzumab.Investigational
MavrilimumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Mavrilimumab.Investigational
Meclofenamic acidThe risk or severity of bleeding and hemorrhage can be increased when Meclofenamic acid is combined with Abciximab.Approved, Vet Approved
MedrogestoneMedrogestone may decrease the anticoagulant activities of Abciximab.Approved
Medroxyprogesterone acetateMedroxyprogesterone acetate may decrease the anticoagulant activities of Abciximab.Approved, Investigational
Mefenamic acidThe risk or severity of bleeding and hemorrhage can be increased when Mefenamic acid is combined with Abciximab.Approved
Megestrol acetateMegestrol acetate may decrease the anticoagulant activities of Abciximab.Approved, Investigational, Vet Approved
MelagatranThe risk or severity of bleeding can be increased when Abciximab is combined with Melagatran.Experimental
MeloxicamThe risk or severity of bleeding and hemorrhage can be increased when Meloxicam is combined with Abciximab.Approved, Vet Approved
MepolizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Mepolizumab.Approved, Investigational
MesalazineThe risk or severity of bleeding can be increased when Mesalazine is combined with Abciximab.Approved
MestranolMestranol may decrease the anticoagulant activities of Abciximab.Approved
MetamizoleThe risk or severity of bleeding and hemorrhage can be increased when Metamizole is combined with Abciximab.Approved, Investigational, Withdrawn
MethallenestrilMethallenestril may decrease the anticoagulant activities of Abciximab.Experimental
Methyl salicylateThe risk or severity of bleeding can be increased when Methyl salicylate is combined with Abciximab.Approved, Vet Approved
MethylestrenoloneMethylestrenolone may decrease the anticoagulant activities of Abciximab.Experimental
MilatuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Milatuzumab.Investigational
MilnacipranMilnacipran may increase the antiplatelet activities of Abciximab.Approved, Investigational
Mirvetuximab SoravtansineThe risk or severity of adverse effects can be increased when Abciximab is combined with Mirvetuximab Soravtansine.Investigational
MofebutazoneThe risk or severity of bleeding and hemorrhage can be increased when Mofebutazone is combined with Abciximab.Experimental
MogamulizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Mogamulizumab.Approved, Investigational
MorniflumateThe risk or severity of bleeding and hemorrhage can be increased when Morniflumate is combined with Abciximab.Approved
Moroctocog alfaThe therapeutic efficacy of Moroctocog alfa can be decreased when used in combination with Abciximab.Approved
MotavizumabThe risk or severity of adverse effects can be increased when Motavizumab is combined with Abciximab.Investigational
MoxestrolMoxestrol may decrease the anticoagulant activities of Abciximab.Experimental
MuromonabThe risk or severity of adverse effects can be increased when Abciximab is combined with Muromonab.Approved, Investigational
MYO-029The risk or severity of adverse effects can be increased when Abciximab is combined with MYO-029.Investigational
NabumetoneThe risk or severity of bleeding and hemorrhage can be increased when Nabumetone is combined with Abciximab.Approved
NadroparinThe risk or severity of bleeding can be increased when Abciximab is combined with Nadroparin.Approved, Investigational
NafamostatThe risk or severity of bleeding can be increased when Abciximab is combined with Nafamostat.Approved, Investigational
NaftopidilNaftopidil may increase the anticoagulant activities of Abciximab.Investigational
NaproxenThe risk or severity of bleeding and hemorrhage can be increased when Naproxen is combined with Abciximab.Approved, Vet Approved
Naptumomab EstafenatoxThe risk or severity of adverse effects can be increased when Abciximab is combined with Naptumomab Estafenatox.Investigational
NatalizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Natalizumab.Approved, Investigational
NebacumabThe risk or severity of adverse effects can be increased when Nebacumab is combined with Abciximab.Experimental
NecitumumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Necitumumab.Approved, Investigational
NefazodoneNefazodone may increase the antiplatelet activities of Abciximab.Approved, Withdrawn
NepafenacThe risk or severity of bleeding and hemorrhage can be increased when Nepafenac is combined with Abciximab.Approved, Investigational
NifenazoneThe risk or severity of bleeding and hemorrhage can be increased when Nifenazone is combined with Abciximab.Experimental
Niflumic AcidThe risk or severity of bleeding and hemorrhage can be increased when Niflumic Acid is combined with Abciximab.Approved
NimesulideNimesulide may increase the anticoagulant activities of Abciximab.Approved, Investigational, Withdrawn
NimotuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Nimotuzumab.Investigational
NintedanibThe risk or severity of bleeding can be increased when Abciximab is combined with Nintedanib.Approved
NitroaspirinThe risk or severity of bleeding can be increased when Nitroaspirin is combined with Abciximab.Investigational
NivolumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Nivolumab.Approved
NomegestrolNomegestrol may decrease the anticoagulant activities of Abciximab.Approved
Nomegestrol acetateNomegestrol acetate may decrease the anticoagulant activities of Abciximab.Approved, Investigational
Nonacog beta pegolThe therapeutic efficacy of Nonacog beta pegol can be decreased when used in combination with Abciximab.Approved, Investigational
NorelgestrominNorelgestromin may decrease the anticoagulant activities of Abciximab.Approved, Investigational
NorethisteroneNorethisterone may decrease the anticoagulant activities of Abciximab.Approved
NorethynodrelNorethynodrel may decrease the anticoagulant activities of Abciximab.Approved
NorgestimateNorgestimate may decrease the anticoagulant activities of Abciximab.Approved, Investigational
NorgestrelNorgestrel may decrease the anticoagulant activities of Abciximab.Approved
NorgestrienoneNorgestrienone may decrease the anticoagulant activities of Abciximab.Experimental
NS-398The risk or severity of bleeding and hemorrhage can be increased when NS-398 is combined with Abciximab.Experimental
ObiltoxaximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Obiltoxaximab.Approved
ObinutuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Obinutuzumab.Approved, Investigational
OcrelizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Ocrelizumab.Approved, Investigational
OfatumumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Ofatumumab.Approved
OlaratumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Olaratumab.Approved, Investigational
OlokizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Olokizumab.Investigational
OlsalazineThe risk or severity of bleeding can be increased when Olsalazine is combined with Abciximab.Approved
Omacetaxine mepesuccinateThe risk or severity of bleeding can be increased when Abciximab is combined with Omacetaxine mepesuccinate.Approved, Investigational
OmalizumabThe risk or severity of adverse effects can be increased when Omalizumab is combined with Abciximab.Approved, Investigational
Omega-3 fatty acidsOmega-3 fatty acids may increase the antiplatelet activities of Abciximab.Approved, Nutraceutical
Omega-3-carboxylic acidsThe therapeutic efficacy of Abciximab can be increased when used in combination with Omega-3-carboxylic acids.Approved, Investigational
OnartuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Onartuzumab.Investigational
OregovomabThe risk or severity of adverse effects can be increased when Abciximab is combined with Oregovomab.Investigational
OtamixabanThe risk or severity of bleeding can be increased when Abciximab is combined with Otamixaban.Investigational
OtelixizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Otelixizumab.Investigational
OxaprozinThe risk or severity of bleeding and hemorrhage can be increased when Oxaprozin is combined with Abciximab.Approved
OxyphenbutazoneThe risk or severity of bleeding and hemorrhage can be increased when Oxyphenbutazone is combined with Abciximab.Approved, Withdrawn
OzanezumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Ozanezumab.Investigational
PalivizumabThe risk or severity of adverse effects can be increased when Palivizumab is combined with Abciximab.Approved, Investigational
PanitumumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Panitumumab.Approved, Investigational
ParecoxibThe risk or severity of bleeding and hemorrhage can be increased when Parecoxib is combined with Abciximab.Approved
ParnaparinThe risk or severity of bleeding can be increased when Abciximab is combined with Parnaparin.Approved, Investigational
ParoxetineParoxetine may increase the antiplatelet activities of Abciximab.Approved, Investigational
PatritumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Patritumab.Investigational
PembrolizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Pembrolizumab.Approved
Pentosan PolysulfateThe risk or severity of adverse effects can be increased when Pentosan Polysulfate is combined with Abciximab.Approved
PentoxifyllinePentoxifylline may increase the antiplatelet activities of Abciximab.Approved, Investigational
PertuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Pertuzumab.Approved
PexelizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Pexelizumab.Investigational
PhenindioneThe risk or severity of bleeding can be increased when Abciximab is combined with Phenindione.Approved, Investigational
PhenprocoumonThe risk or severity of bleeding can be increased when Abciximab is combined with Phenprocoumon.Approved, Investigational
Phenyl aminosalicylateThe risk or severity of bleeding can be increased when Phenyl aminosalicylate is combined with Abciximab.Approved
PhenylbutazoneThe risk or severity of bleeding and hemorrhage can be increased when Phenylbutazone is combined with Abciximab.Approved, Vet Approved
PicotamidePicotamide may increase the anticoagulant activities of Abciximab.Experimental
PiroxicamThe risk or severity of bleeding and hemorrhage can be increased when Piroxicam is combined with Abciximab.Approved, Investigational
PirprofenThe risk or severity of bleeding and hemorrhage can be increased when Pirprofen is combined with Abciximab.Experimental
Platelet Activating FactorThe therapeutic efficacy of Platelet Activating Factor can be decreased when used in combination with Abciximab.Experimental
Polatuzumab VedotinThe risk or severity of adverse effects can be increased when Abciximab is combined with Polatuzumab Vedotin.Investigational
Polyestradiol phosphatePolyestradiol phosphate may decrease the anticoagulant activities of Abciximab.Approved
Potassium CitrateThe risk or severity of bleeding can be increased when Abciximab is combined with Potassium Citrate.Approved, Investigational, Vet Approved
PranoprofenThe risk or severity of bleeding and hemorrhage can be increased when Pranoprofen is combined with Abciximab.Experimental, Investigational
PrasugrelThe risk or severity of bleeding can be increased when Abciximab is combined with Prasugrel.Approved
PRO 140The risk or severity of adverse effects can be increased when Abciximab is combined with PRO 140.Investigational
PRO-542The risk or severity of adverse effects can be increased when Abciximab is combined with PRO-542.Investigational
ProgesteroneProgesterone may decrease the anticoagulant activities of Abciximab.Approved, Vet Approved
ProglumetacinThe risk or severity of bleeding and hemorrhage can be increased when Proglumetacin is combined with Abciximab.Experimental
PromegestonePromegestone may decrease the anticoagulant activities of Abciximab.Experimental
PromestrienePromestriene may decrease the anticoagulant activities of Abciximab.Investigational
PropacetamolThe risk or severity of bleeding and hemorrhage can be increased when Propacetamol is combined with Abciximab.Approved, Investigational
PropyphenazoneThe risk or severity of bleeding and hemorrhage can be increased when Propyphenazone is combined with Abciximab.Experimental
ProquazoneThe risk or severity of bleeding and hemorrhage can be increased when Proquazone is combined with Abciximab.Experimental
Protein CThe risk or severity of bleeding can be increased when Protein C is combined with Abciximab.Approved
Protein S humanThe risk or severity of bleeding can be increased when Abciximab is combined with Protein S human.Approved
ProthrombinThe therapeutic efficacy of Prothrombin can be decreased when used in combination with Abciximab.Approved
ProtocatechualdehydeThe risk or severity of bleeding can be increased when Abciximab is combined with Protocatechualdehyde.Approved
QuinestrolQuinestrol may decrease the anticoagulant activities of Abciximab.Approved
QuingestanolQuingestanol may decrease the anticoagulant activities of Abciximab.Experimental
R1507The risk or severity of adverse effects can be increased when Abciximab is combined with R1507.Investigational
RacotumomabThe risk or severity of adverse effects can be increased when Abciximab is combined with Racotumomab.Investigational
RamatrobanRamatroban may increase the anticoagulant activities of Abciximab.Investigational
RamucirumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Ramucirumab.Approved, Investigational
RanibizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Ranibizumab.Approved
RaxibacumabThe risk or severity of adverse effects can be increased when Raxibacumab is combined with Abciximab.Approved
RelcovaptanRelcovaptan may increase the anticoagulant activities of Abciximab.Investigational
ReslizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Reslizumab.Approved, Investigational
ResveratrolResveratrol may increase the anticoagulant activities of Abciximab.Approved, Experimental, Investigational
ReteplaseThe risk or severity of bleeding can be increased when Reteplase is combined with Abciximab.Approved, Investigational
ReviparinThe risk or severity of bleeding can be increased when Abciximab is combined with Reviparin.Approved, Investigational
RI 624The risk or severity of adverse effects can be increased when Abciximab is combined with RI 624.Investigational
RidogrelRidogrel may increase the anticoagulant activities of Abciximab.Approved
RIGScan CR49The risk or severity of adverse effects can be increased when Abciximab is combined with RIGScan CR49.Investigational
RilotumumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Rilotumumab.Investigational
RitanserinRitanserin may increase the antiplatelet activities of Abciximab.Investigational
RituximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Rituximab.Approved
RivaroxabanAbciximab may increase the anticoagulant activities of Rivaroxaban.Approved
RobatumumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Robatumumab.Investigational
RobenacoxibThe risk or severity of bleeding and hemorrhage can be increased when Robenacoxib is combined with Abciximab.Experimental, Vet Approved
RofecoxibThe risk or severity of bleeding and hemorrhage can be increased when Rofecoxib is combined with Abciximab.Approved, Investigational, Withdrawn
RomosozumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Romosozumab.Investigational
RontalizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Rontalizumab.Investigational
Rusalatide acetateThe therapeutic efficacy of Rusalatide acetate can be decreased when used in combination with Abciximab.Investigational
Sacituzumab govitecanThe risk or severity of adverse effects can be increased when Abciximab is combined with Sacituzumab govitecan.Investigational
SalicylamideThe risk or severity of bleeding and hemorrhage can be increased when Salicylamide is combined with Abciximab.Approved
Salicylic acidThe risk or severity of bleeding can be increased when Salicylic acid is combined with Abciximab.Approved, Investigational, Vet Approved
SalsalateThe risk or severity of bleeding and hemorrhage can be increased when Salsalate is combined with Abciximab.Approved
SarilumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Sarilumab.Approved, Investigational
SarpogrelateSarpogrelate may increase the anticoagulant activities of Abciximab.Investigational
SaruplaseThe risk or severity of bleeding can be increased when Saruplase is combined with Abciximab.Experimental
SC-236The risk or severity of bleeding and hemorrhage can be increased when SC-236 is combined with Abciximab.Experimental, Investigational
SecukinumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Secukinumab.Approved
SeribantumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Seribantumab.Investigational
SertralineSertraline may increase the antiplatelet activities of Abciximab.Approved
SevofluraneSevoflurane may increase the anticoagulant activities of Abciximab.Approved, Vet Approved
SibrotuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Sibrotuzumab.Investigational
SibutramineSibutramine may increase the antiplatelet activities of Abciximab.Approved, Illicit, Investigational, Withdrawn
SiltuximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Siltuximab.Approved, Investigational
SiplizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Siplizumab.Investigational
SirukumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Sirukumab.Investigational
Sodium CitrateThe risk or severity of bleeding can be increased when Abciximab is combined with Sodium Citrate.Approved, Investigational
SolanezumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Solanezumab.Investigational
SotaterceptThe risk or severity of adverse effects can be increased when Abciximab is combined with Sotatercept.Investigational
StreptokinaseThe risk or severity of bleeding can be increased when Streptokinase is combined with Abciximab.Approved, Investigational
SugammadexThe risk or severity of bleeding and hemorrhage can be increased when Abciximab is combined with Sugammadex.Approved
SulesomabThe risk or severity of adverse effects can be increased when Abciximab is combined with Sulesomab.Approved
SulfasalazineThe risk or severity of bleeding can be increased when Sulfasalazine is combined with Abciximab.Approved
SulfinpyrazoneSulfinpyrazone may increase the anticoagulant activities of Abciximab.Approved
SulindacThe risk or severity of bleeding and hemorrhage can be increased when Sulindac is combined with Abciximab.Approved, Investigational
SulodexideThe risk or severity of bleeding can be increased when Sulodexide is combined with Abciximab.Approved, Investigational
SuprofenThe risk or severity of bleeding and hemorrhage can be increased when Suprofen is combined with Abciximab.Approved, Withdrawn
Susoctocog alfaThe therapeutic efficacy of Susoctocog alfa can be decreased when used in combination with Abciximab.Approved, Investigational
SuxibuzoneThe risk or severity of bleeding and hemorrhage can be increased when Suxibuzone is combined with Abciximab.Experimental
SYM001The risk or severity of adverse effects can be increased when Abciximab is combined with SYM001.Investigational
Synthetic Conjugated Estrogens, ASynthetic Conjugated Estrogens, A may decrease the anticoagulant activities of Abciximab.Approved
Synthetic Conjugated Estrogens, BSynthetic Conjugated Estrogens, B may decrease the anticoagulant activities of Abciximab.Approved
TabalumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Tabalumab.Investigational
TalniflumateThe risk or severity of bleeding and hemorrhage can be increased when Talniflumate is combined with Abciximab.Approved
TanezumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Tanezumab.Investigational
TarextumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Tarextumab.Investigational
TB-402The risk or severity of adverse effects can be increased when Abciximab is combined with TB-402.Investigational
Technetium Tc-99m arcitumomabThe risk or severity of adverse effects can be increased when Abciximab is combined with Technetium Tc-99m arcitumomab.Approved, Investigational
TenecteplaseThe risk or severity of bleeding can be increased when Tenecteplase is combined with Abciximab.Approved
TenidapThe risk or severity of bleeding and hemorrhage can be increased when Tenidap is combined with Abciximab.Experimental
TenoxicamThe risk or severity of bleeding and hemorrhage can be increased when Tenoxicam is combined with Abciximab.Approved
TeplizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Teplizumab.Investigational
TepoxalinThe risk or severity of bleeding and hemorrhage can be increased when Tepoxalin is combined with Abciximab.Vet Approved
TesmilifeneTesmilifene may increase the anticoagulant activities of Abciximab.Investigational
Testosterone cypionateThe therapeutic efficacy of Abciximab can be increased when used in combination with Testosterone cypionate.Approved
Testosterone enanthateThe therapeutic efficacy of Abciximab can be increased when used in combination with Testosterone enanthate.Approved
Testosterone undecanoateThe therapeutic efficacy of Abciximab can be increased when used in combination with Testosterone undecanoate.Approved, Investigational
Tetanus Immune GlobulinThe risk or severity of adverse effects can be increased when Abciximab is combined with Tetanus Immune Globulin.Approved
ThrombinThe therapeutic efficacy of Thrombin can be decreased when used in combination with Abciximab.Approved, Investigational
Tiaprofenic acidThe risk or severity of bleeding and hemorrhage can be increased when Tiaprofenic acid is combined with Abciximab.Approved
TiboloneTibolone may increase the anticoagulant activities of Abciximab.Approved, Investigational
TicagrelorThe risk or severity of bleeding can be increased when Abciximab is combined with Ticagrelor.Approved
TiclopidineTiclopidine may increase the anticoagulant activities of Abciximab.Approved
TildrakizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Tildrakizumab.Approved, Investigational
TinoridineThe risk or severity of bleeding and hemorrhage can be increased when Tinoridine is combined with Abciximab.Investigational
TinzaparinThe risk or severity of bleeding can be increased when Tinzaparin is combined with Abciximab.Approved
TioclomarolThe risk or severity of bleeding can be increased when Abciximab is combined with Tioclomarol.Experimental
TipranavirTipranavir may increase the antiplatelet activities of Abciximab.Approved, Investigational
TirofibanTirofiban may increase the anticoagulant activities of Abciximab.Approved
TNX-901The risk or severity of adverse effects can be increased when Abciximab is combined with TNX-901.Investigational
TocilizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Tocilizumab.Approved
TocopherylquinoneThe risk or severity of bleeding can be increased when Abciximab is combined with Tocopherylquinone.Experimental, Investigational
Tolfenamic AcidThe risk or severity of bleeding and hemorrhage can be increased when Tolfenamic Acid is combined with Abciximab.Approved, Investigational
TolmetinThe risk or severity of bleeding and hemorrhage can be increased when Tolmetin is combined with Abciximab.Approved
TositumomabThe risk or severity of adverse effects can be increased when Abciximab is combined with Tositumomab.Approved, Investigational
TositumomabThe risk or severity of bleeding and hemorrhage can be increased when Abciximab is combined with Tositumomab.Approved, Investigational
TovetumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Tovetumab.Investigational
TralokinumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Tralokinumab.Investigational
TranilastTranilast may increase the anticoagulant activities of Abciximab.Approved, Investigational
TrapidilTrapidil may increase the anticoagulant activities of Abciximab.Approved
TrastuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Trastuzumab.Approved, Investigational
Trastuzumab emtansineThe risk or severity of adverse effects can be increased when Abciximab is combined with Trastuzumab emtansine.Approved, Investigational
TrazodoneTrazodone may increase the antiplatelet activities of Abciximab.Approved, Investigational
TRC105The risk or severity of adverse effects can be increased when Abciximab is combined with TRC105.Investigational
TremelimumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Tremelimumab.Investigational
Trenonacog alfaThe therapeutic efficacy of Trenonacog alfa can be decreased when used in combination with Abciximab.Investigational
TreprostinilThe risk or severity of adverse effects can be increased when Abciximab is combined with Treprostinil.Approved, Investigational
TriflusalThe risk or severity of bleeding can be increased when Abciximab is combined with Triflusal.Approved, Investigational
Trolamine salicylateThe risk or severity of bleeding can be increased when Trolamine salicylate is combined with Abciximab.Approved
TroxerutinThe risk or severity of bleeding can be increased when Abciximab is combined with Troxerutin.Investigational
Turoctocog alfaThe therapeutic efficacy of Turoctocog alfa can be decreased when used in combination with Abciximab.Approved, Investigational
UrokinaseUrokinase may increase the anticoagulant activities of Abciximab.Approved, Investigational, Withdrawn
UstekinumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Ustekinumab.Approved, Investigational
ValdecoxibThe risk or severity of bleeding and hemorrhage can be increased when Valdecoxib is combined with Abciximab.Approved, Investigational, Withdrawn
Vatreptacog alfaThe therapeutic efficacy of Vatreptacog alfa can be decreased when used in combination with Abciximab.Investigational
VedolizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Vedolizumab.Approved
VeltuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Veltuzumab.Investigational
VenlafaxineVenlafaxine may increase the antiplatelet activities of Abciximab.Approved
VisilizumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Visilizumab.Investigational
Vitamin EVitamin E may increase the antiplatelet activities of Abciximab.Approved, Nutraceutical, Vet Approved
VolociximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Volociximab.Investigational
Von Willebrand Factor HumanThe therapeutic efficacy of Von Willebrand Factor Human can be decreased when used in combination with Abciximab.Approved, Investigational
VorapaxarThe risk or severity of bleeding and hemorrhage can be increased when Vorapaxar is combined with Abciximab.Approved
WarfarinThe risk or severity of bleeding can be increased when Abciximab is combined with Warfarin.Approved
XimelagatranThe risk or severity of bleeding can be increased when Abciximab is combined with Ximelagatran.Approved, Investigational, Withdrawn
XmAb 2513The risk or severity of adverse effects can be increased when Abciximab is combined with XmAb 2513.Investigational
XTL-001The risk or severity of adverse effects can be increased when Abciximab is combined with XTL-001.Investigational
ZaltoprofenThe risk or severity of bleeding and hemorrhage can be increased when Zaltoprofen is combined with Abciximab.Approved, Investigational
ZeranolZeranol may decrease the anticoagulant activities of Abciximab.Vet Approved
ZimelidineZimelidine may increase the antiplatelet activities of Abciximab.Withdrawn
ZomepiracThe risk or severity of bleeding and hemorrhage can be increased when Zomepirac is combined with Abciximab.Withdrawn
Food Interactions
Not Available

References

General References
  1. Authors unspecified: Use of a monoclonal antibody directed against the platelet glycoprotein IIb/IIIa receptor in high-risk coronary angioplasty. The EPIC Investigation. N Engl J Med. 1994 Apr 7;330(14):956-61. [PubMed:8121459]
  2. Tcheng JE, Kandzari DE, Grines CL, Cox DA, Effron MB, Garcia E, Griffin JJ, Guagliumi G, Stuckey T, Turco M, Fahy M, Lansky AJ, Mehran R, Stone GW: Benefits and risks of abciximab use in primary angioplasty for acute myocardial infarction: the Controlled Abciximab and Device Investigation to Lower Late Angioplasty Complications (CADILLAC) trial. Circulation. 2003 Sep 16;108(11):1316-23. Epub 2003 Aug 25. [PubMed:12939213]
External Links
KEGG Drug
D02778
PubChem Substance
46505910
ChEMBL
CHEMBL1201584
Therapeutic Targets Database
DAP000473
PharmGKB
PA448006
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Abciximab
ATC Codes
B01AC13 — Abciximab
AHFS Codes
  • 92:00.00 — Miscellaneous Therapeutic Agents
FDA label
Download (220 KB)
MSDS
Download (19.7 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1, 2WithdrawnNot AvailableCarotid Stenosis1
2Active Not RecruitingOtherAcute Myocardial Infarction (AMI)1
2CompletedTreatmentCerebrovascular Accidents2
2CompletedTreatmentNon ST Segment Elevation Myocardial Infarction (NSTEMI) / Stable Angina (Associated With High Risk PCI) / Unstable Angina (UA)1
2CompletedTreatmentStable Angina (SA)1
2Unknown StatusPreventionPatients Above 18 Years1
2WithdrawnTreatmentHb-SS Disease With Vasoocclusive Pain / Hemoglobin SS Disease With Crisis / Hemoglobin SS Disease With Vasoocclusive Crisis / Other Sickle Cell Disease With Vaso-Occlusive Pain / Sickle Cell Disorders1
2, 3Unknown StatusPreventionArterial Occlusive Diseases1
3CompletedTreatmentAngioplasty, Transluminal, Percutaneous Coronary1
3CompletedTreatmentAngioplasty, Transluminal, Percutaneous Coronary / Unstable Angina (UA)2
3CompletedTreatmentMyocardial Infarction2
3TerminatedTreatmentAcute Disease / Cerebrovascular Accidents / Ischemia, Brain1
3TerminatedTreatmentAcute Myocardial Infarction (AMI)1
3TerminatedTreatmentStenosis / Strokes1
3TerminatedTreatmentStrokes1
3Unknown StatusTreatmentMyocardial Infarction1
4CompletedNot AvailableCoronary Artery Disease1
4CompletedTreatmentAcute Myocardial Infarction (AMI)2
4CompletedTreatmentAngina Pectoris / Coronary Heart Disease (CHD)1
4CompletedTreatmentCoronary Artery Disease / Transient ischemia attacks1
4CompletedTreatmentCoronary Heart Disease (CHD) / Myocardial Infarction1
4CompletedTreatmentCoronary Heart Disease (CHD) / Unstable Angina (UA)1
4CompletedTreatmentDiabetes Mellitus (DM)1
4CompletedTreatmentMyocardial Infarction3
4CompletedTreatmentMyocardial Infarction / Transient ischemia attacks2
4CompletedTreatmentShock, Cardiogenic1
4TerminatedNot AvailableCoronary Heart Disease (CHD) / Myocardial Infarction1
4Unknown StatusTreatmentAngioplasty / Myocardial Infarction1
4Unknown StatusTreatmentPrimary Percutaneous Coronary Intervention / ST Elevation Myocardial Infarction (STEMI)1
4Unknown StatusTreatmentST Elevation Myocardial Infarction (STEMI)1
Not AvailableCompletedTreatmentAtherosclerosis / Ischaemic Heart Diseases1
Not AvailableUnknown StatusTreatmentCoronary Artery Disease / Myocardial Infarction1
Not AvailableUnknown StatusTreatmentST Elevation Myocardial Infarction (STEMI)1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • Centocor Ortho Biotech Inc.
  • Eli Lilly & Co.
  • Hospira Inc.
  • JHP Pharmaceuticals LLC
Dosage forms
FormRouteStrength
Injection, solutionIntravenous2 mg/mL
SolutionIntravenous2 mg
Prices
Unit descriptionCostUnit
Reopro 2 mg/ml vial155.77USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1341357No2002-05-072019-05-07Canada

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.424Not Available
isoelectric point6.16Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antagonist
General Function
Virus receptor activity
Specific Function
Integrin alpha-V/beta-3 (ITGAV:ITGB3) is a receptor for cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin and von Wil...
Gene Name
ITGB3
Uniprot ID
P05106
Uniprot Name
Integrin beta-3
Molecular Weight
87056.975 Da
References
  1. Amoroso G, van Boven AJ, van Veldhuisen DJ, Tio RA, Balje-Volkers CP, Petronio AS, van Oeveren W: Eptifibatide and abciximab exhibit equivalent antiplatelet efficacy in an experimental model of stenting in both healthy volunteers and patients with coronary artery disease. J Cardiovasc Pharmacol. 2001 Oct;38(4):633-41. [PubMed:11588534]
  2. Weber AA, Meila D, Jacobs C, Weber S, Kelm M, Strauer BE, Zotz RB, Scharf RE, Schror K: Low incidence of paradoxical platelet activation by glycoprotein IIb/IIIa inhibitors. Thromb Res. 2002 Apr 1;106(1):25-9. [PubMed:12165285]
  3. Hall PR, Malone L, Sillerud LO, Ye C, Hjelle BL, Larson RS: Characterization and NMR solution structure of a novel cyclic pentapeptide inhibitor of pathogenic hantaviruses. Chem Biol Drug Des. 2007 Mar;69(3):180-90. [PubMed:17441904]
  4. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
  5. Mazzaferri EL Jr, Young JJ: Abciximab: a review and update for clinicians. Expert Rev Cardiovasc Ther. 2008 Jun;6(5):609-18. doi: 10.1586/14779072.6.5.609. [PubMed:18510478]
  6. Ibbotson T, McGavin JK, Goa KL: Abciximab: an updated review of its therapeutic use in patients with ischaemic heart disease undergoing percutaneous coronary revascularisation. Drugs. 2003;63(11):1121-63. [PubMed:12749745]
Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antagonist
General Function
Metal ion binding
Specific Function
Integrin alpha-IIb/beta-3 is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. It recognizes the sequence R-G-D in a wide array of ligands. It recogn...
Gene Name
ITGA2B
Uniprot ID
P08514
Uniprot Name
Integrin alpha-IIb
Molecular Weight
113375.96 Da
References
  1. Gibbs NM: Point-of-care assessment of antiplatelet agents in the perioperative period: a review. Anaesth Intensive Care. 2009 May;37(3):354-69. [PubMed:19499855]
  2. Mazzaferri EL Jr, Young JJ: Abciximab: a review and update for clinicians. Expert Rev Cardiovasc Ther. 2008 Jun;6(5):609-18. doi: 10.1586/14779072.6.5.609. [PubMed:18510478]
  3. Ibbotson T, McGavin JK, Goa KL: Abciximab: an updated review of its therapeutic use in patients with ischaemic heart disease undergoing percutaneous coronary revascularisation. Drugs. 2003;63(11):1121-63. [PubMed:12749745]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent...
Gene Name
FCGR3B
Uniprot ID
O75015
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-B
Molecular Weight
26215.64 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type peptidase activity
Specific Function
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name
C1R
Uniprot ID
P00736
Uniprot Name
Complement C1r subcomponent
Molecular Weight
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QA
Uniprot ID
P02745
Uniprot Name
Complement C1q subcomponent subunit A
Molecular Weight
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QB
Uniprot ID
P02746
Uniprot Name
Complement C1q subcomponent subunit B
Molecular Weight
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QC
Uniprot ID
P02747
Uniprot Name
Complement C1q subcomponent subunit C
Molecular Weight
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as...
Gene Name
FCGR3A
Uniprot ID
P08637
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-A
Molecular Weight
29088.895 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type endopeptidase activity
Specific Function
C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activat...
Gene Name
C1S
Uniprot ID
P09871
Uniprot Name
Complement C1s subcomponent
Molecular Weight
76683.905 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Receptor signaling protein activity
Specific Function
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name
FCGR1A
Uniprot ID
P12314
Uniprot Name
High affinity immunoglobulin gamma Fc receptor I
Molecular Weight
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized ...
Gene Name
FCGR2A
Uniprot ID
P12318
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-a
Molecular Weight
35000.42 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complex...
Gene Name
FCGR2B
Uniprot ID
P31994
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-b
Molecular Weight
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Transmembrane signaling receptor activity
Specific Function
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulat...
Gene Name
FCGR2C
Uniprot ID
P31995
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-c
Molecular Weight
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Scavenger receptor activity
Specific Function
Vitronectin is a cell adhesion and spreading factor found in serum and tissues. Vitronectin interact with glycosaminoglycans and proteoglycans. Is recognized by certain members of the integrin fami...
Gene Name
VTN
Uniprot ID
P04004
Uniprot Name
Vitronectin
Molecular Weight
54305.135 Da
References
  1. Romagnoli E, Burzotta F, Trani C, Biondi-Zoccai GG, Giannico F, Crea F: Rationale for intracoronary administration of abciximab. J Thromb Thrombolysis. 2007 Feb;23(1):57-63. [PubMed:17160551]
  2. Ibbotson T, McGavin JK, Goa KL: Abciximab: an updated review of its therapeutic use in patients with ischaemic heart disease undergoing percutaneous coronary revascularisation. Drugs. 2003;63(11):1121-63. [PubMed:12749745]

Drug created on June 13, 2005 07:24 / Updated on August 15, 2018 09:34