Identification

Name
Abciximab
Accession Number
DB00054  (BTD00041, BIOD00041)
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Abciximab is a Fab fragment of the chimeric human-murine monoclonal antibody 7E3. Abciximab binds to the glycoprotein (GP) IIb/IIIa receptor of human platelets and inhibits platelet aggregation by preventing the binding of fibrinogen, von Willebrand factor, and other adhesive molecules. It also binds to vitronectin (αvβ3) receptor found on platelets and vessel wall endothelial and smooth muscle cells.

Protein structure
Db00054
Protein chemical formula
C6462H9964N1690O2049S48
Protein average weight
145651.1 Da
Sequences
>1TXV:H ReoPro-like antibody Heavy Chain 1
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKY
DPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSA
KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE
LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>1TXV:L ReoPro-like antibody Light Chain 1
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPS
RFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>1TXV:H ReoPro-like antibody Heavy Chain 2
EVQLQQSGAELVKPGASVKLSCTASGFNIKDTYVHWVKQRPEQGLEWIGRIDPANGYTKY
DPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCVRPLYDYYAMDYWGQGTSVTVSSA
KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRPKSCDKTHTCPPCPAPELLGG
PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN
STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE
LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW
QQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>1TXV:L ReoPro-like antibody Light Chain 2
DILMTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFMGLIYYGTNLVDGVPS
RFSGSGSGADYSLTISSLDSEDFADYYCVQYAQLPYTFGGGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Download FASTA Format
Synonyms
  • 7E3
  • 7E3 antibody
  • Abciximab (genetical recombination)
  • antiGPIIBIIIa
  • c7E3
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
ReoproInjection, solution2 mg/mLIntravenousJanssen Biotech, Inc.2017-01-03Not applicableUs
ReoproSolution2 mgIntravenousJanssen Pharmaceuticals1996-10-30Not applicableCanada
ReoproInjection, solution2 mg/mLIntravenousEli Lilly & Co. Ltd.1993-12-16Not applicableUs
Categories
UNII
X85G7936GV
CAS number
143653-53-6

Pharmacology

Indication

Abciximab is indicated as an adjunct to percutaneous coronary intervention for the prevention of cardiac ischemic complications in patients undergoing percutaneous coronary intervention and in patients with unstable angina not responding to conventional medical therapy when percutaneous coronary intervention is planned within 24 hours. Abciximab is intended for use with aspirin and heparin and has been studied only in that setting.

Structured Indications
Pharmacodynamics

Abciximab inhibits platelet aggregation by preventing the binding of fibrinogen, von Willebrand factor, and other adhesive molecules to GPIIb/IIIa receptor sites on activated platelets. A single intravenous bolus dose from 0.15 mg/kg to 0.30 mg/kg produced rapid dose-dependent inhibition of platelet function. After two hours post-injection with a dose of 0.25 - 0.30 mg/kg, 80% of the GPIIb/IIIa receptors were blocked and platelet aggregation was prevented. GPIIb/IIIa is the major surface receptor involved in the final pathway of platelet aggregation. Bleeding time increases to over 30 minutes at the aforementioned doses. To compare, baseline values were five minutes.

Mechanism of action

Abciximab binds to the intact platelet GPIIb/IIIa receptor, which is a member of the integrin family of adhesion receptors and the major platelet surface receptor involved in platelet aggregation. This binding is thought to involve steric hindrance and/or conformational alterations which block access of large molecules to the receptor rather than direct interaction with the RGD (arginine-glycine-aspartic acid) binding site of GPIIb/IIIa. By binding to the vitronectin receptor (also known as the αvβ3 integrin), abciximab blocks effects mediated by this integrin which include cell adhesion. Furthermore, abciximab blocks Mac-1 receptor on monocytes and neutrophils thus inhibiting monocyte adhesion.

TargetActionsOrganism
AIntegrin beta-3
antagonist
Human
AIntegrin alpha-IIb
antagonist
Human
ULow affinity immunoglobulin gamma Fc region receptor III-BNot AvailableHuman
UComplement C1r subcomponentNot AvailableHuman
UComplement C1q subcomponent subunit ANot AvailableHuman
UComplement C1q subcomponent subunit BNot AvailableHuman
UComplement C1q subcomponent subunit CNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor III-ANot AvailableHuman
UComplement C1s subcomponentNot AvailableHuman
UHigh affinity immunoglobulin gamma Fc receptor INot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-aNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-bNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-cNot AvailableHuman
UVitronectinNot AvailableHuman
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system when bound to platelets, or by human antimurine antibody production. Excreted renally.

Route of elimination
Not Available
Half life

Following intravenous bolus administration, free plasma concentrations of Abciximab decrease rapidly with an initial half-life of less than 10 minutes and a second phase half-life of about 30 minutes, probably related to rapid binding to the platelet GPIIb/IIIa receptors.

Clearance
Not Available
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
PathwayCategory
Abciximab Action PathwayDrug action
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteractionDrug group
AceclofenacAceclofenac may increase the anticoagulant activities of Abciximab.Approved, Investigational
AcemetacinAcemetacin may increase the anticoagulant activities of Abciximab.Approved
AcenocoumarolAbciximab may increase the anticoagulant activities of Acenocoumarol.Approved
Acetylsalicylic acidThe risk or severity of adverse effects can be increased when Abciximab is combined with Acetylsalicylic acid.Approved, Vet Approved
AdapaleneAdapalene may increase the anticoagulant activities of Abciximab.Approved
AlclofenacAlclofenac may increase the anticoagulant activities of Abciximab.Approved, Withdrawn
AllylestrenolThe therapeutic efficacy of Abciximab can be decreased when used in combination with Allylestrenol.Approved
AlminoprofenAlminoprofen may increase the anticoagulant activities of Abciximab.Experimental
AloxiprinThe risk or severity of adverse effects can be increased when Abciximab is combined with Aloxiprin.Experimental
AlprostadilAlprostadil may increase the anticoagulant activities of Abciximab.Approved, Investigational
AlteplaseAlteplase may increase the anticoagulant activities of Abciximab.Approved
AltrenogestThe therapeutic efficacy of Abciximab can be decreased when used in combination with Altrenogest.Vet Approved
ALX-0081ALX-0081 may increase the anticoagulant activities of Abciximab.Investigational
Aminosalicylic AcidThe risk or severity of adverse effects can be increased when Abciximab is combined with Aminosalicylic Acid.Approved
AnagrelideAnagrelide may increase the anticoagulant activities of Abciximab.Approved
AncrodAbciximab may increase the anticoagulant activities of Ancrod.Investigational
AndrographolideAndrographolide may increase the anticoagulant activities of Abciximab.Investigational
AnisodamineAnisodamine may increase the anticoagulant activities of Abciximab.Investigational
AnistreplaseAnistreplase may increase the anticoagulant activities of Abciximab.Approved
AntipyrineAntipyrine may increase the anticoagulant activities of Abciximab.Approved
Antithrombin III humanAbciximab may increase the anticoagulant activities of Antithrombin III human.Approved
ApixabanThe risk or severity of adverse effects can be increased when Abciximab is combined with Apixaban.Approved
ApocyninApocynin may increase the anticoagulant activities of Abciximab.Investigational
ApremilastApremilast may increase the anticoagulant activities of Abciximab.Approved, Investigational
AprotininThe therapeutic efficacy of Abciximab can be decreased when used in combination with Aprotinin.Approved, Withdrawn
ArdeparinAbciximab may increase the anticoagulant activities of Ardeparin.Approved, Investigational, Withdrawn
ArgatrobanAbciximab may increase the anticoagulant activities of Argatroban.Approved, Investigational
AstaxanthinAstaxanthin may increase the anticoagulant activities of Abciximab.Investigational
AzapropazoneAzapropazone may increase the anticoagulant activities of Abciximab.Withdrawn
AzelastineAzelastine may increase the anticoagulant activities of Abciximab.Approved
BalsalazideBalsalazide may increase the anticoagulant activities of Abciximab.Approved, Investigational
BatroxobinBatroxobin may increase the anticoagulant activities of Abciximab.Experimental
BCG vaccineThe therapeutic efficacy of BCG vaccine can be decreased when used in combination with Abciximab.Investigational
BecaplerminAbciximab may increase the anticoagulant activities of Becaplermin.Approved, Investigational
BemiparinBemiparin may increase the anticoagulant activities of Abciximab.Approved, Investigational
BendazacBendazac may increase the anticoagulant activities of Abciximab.Experimental
BenorilateBenorilate may increase the anticoagulant activities of Abciximab.Experimental
BenoxaprofenBenoxaprofen may increase the anticoagulant activities of Abciximab.Withdrawn
BenzydamineBenzydamine may increase the anticoagulant activities of Abciximab.Approved
BeraprostBeraprost may increase the anticoagulant activities of Abciximab.Investigational
BevoniumBevonium may increase the anticoagulant activities of Abciximab.Experimental
BivalirudinBivalirudin may increase the anticoagulant activities of Abciximab.Approved, Investigational
BrinaseBrinase may increase the anticoagulant activities of Abciximab.Experimental
BromfenacBromfenac may increase the anticoagulant activities of Abciximab.Approved
BucillamineBucillamine may increase the anticoagulant activities of Abciximab.Investigational
BufexamacBufexamac may increase the anticoagulant activities of Abciximab.Experimental
BuflomedilBuflomedil may increase the anticoagulant activities of Abciximab.Experimental
BumadizoneBumadizone may increase the anticoagulant activities of Abciximab.Experimental
ButylphthalideButylphthalide may increase the anticoagulant activities of Abciximab.Investigational
CangrelorCangrelor may increase the anticoagulant activities of Abciximab.Approved
Carbaspirin calciumThe risk or severity of adverse effects can be increased when Abciximab is combined with Carbaspirin calcium.Experimental, Investigational
CarprofenCarprofen may increase the anticoagulant activities of Abciximab.Approved, Vet Approved, Withdrawn
CastanospermineCastanospermine may increase the anticoagulant activities of Abciximab.Experimental
CelecoxibCelecoxib may increase the anticoagulant activities of Abciximab.Approved, Investigational
CertoparinAbciximab may increase the anticoagulant activities of Certoparin.Approved, Investigational
ChloroquineChloroquine may increase the anticoagulant activities of Abciximab.Approved, Vet Approved
ChlorotrianiseneChlorotrianisene may decrease the anticoagulant activities of Abciximab.Investigational, Withdrawn
Choline magnesium trisalicylateCholine magnesium trisalicylate may increase the anticoagulant activities of Abciximab.Approved
CilostazolCilostazol may increase the anticoagulant activities of Abciximab.Approved
Citric AcidAbciximab may increase the anticoagulant activities of Citric Acid.Approved, Nutraceutical, Vet Approved
ClonixinClonixin may increase the anticoagulant activities of Abciximab.Approved
ClopidogrelClopidogrel may increase the anticoagulant activities of Abciximab.Approved, Nutraceutical
CloricromenCloricromen may increase the anticoagulant activities of Abciximab.Experimental
ClorindioneClorindione may increase the anticoagulant activities of Abciximab.Experimental
Clostridium tetani toxoid antigen (formaldehyde inactivated)The therapeutic efficacy of Clostridium tetani toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Abciximab.Approved
Collagenase clostridium histolyticumThe risk or severity of adverse effects can be increased when Abciximab is combined with Collagenase clostridium histolyticum.Approved, Investigational
Conjugated estrogensConjugated estrogens may decrease the anticoagulant activities of Abciximab.Approved
Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated)The therapeutic efficacy of Corynebacterium diphtheriae toxoid antigen (formaldehyde inactivated) can be decreased when used in combination with Abciximab.Approved
CurcuminCurcumin may increase the anticoagulant activities of Abciximab.Investigational
D-LimoneneD-Limonene may increase the anticoagulant activities of Abciximab.Investigational
Dabigatran etexilateAbciximab may increase the anticoagulant activities of Dabigatran etexilate.Approved
DaidzeinDaidzein may decrease the anticoagulant activities of Abciximab.Experimental
DalteparinAbciximab may increase the anticoagulant activities of Dalteparin.Approved
DanaparoidAbciximab may increase the anticoagulant activities of Danaparoid.Approved, Withdrawn
DarexabanAbciximab may increase the anticoagulant activities of Darexaban.Investigational
DasatinibDasatinib may increase the anticoagulant activities of Abciximab.Approved, Investigational
DeferasiroxThe risk or severity of adverse effects can be increased when Abciximab is combined with Deferasirox.Approved, Investigational
DefibrotideDefibrotide may increase the anticoagulant activities of Abciximab.Approved, Investigational
DemegestoneThe therapeutic efficacy of Abciximab can be decreased when used in combination with Demegestone.Experimental
Deoxycholic AcidThe risk or severity of adverse effects can be increased when Abciximab is combined with Deoxycholic Acid.Approved
dersalazineThe risk or severity of adverse effects can be increased when Abciximab is combined with dersalazine.Investigational
DesirudinAbciximab may increase the anticoagulant activities of Desirudin.Approved
DesmoteplaseDesmoteplase may increase the anticoagulant activities of Abciximab.Investigational
DesogestrelThe therapeutic efficacy of Abciximab can be decreased when used in combination with Desogestrel.Approved
DextranDextran may increase the anticoagulant activities of Abciximab.Approved, Vet Approved
Dextran 40Abciximab may increase the anticoagulant activities of Dextran 40.Approved
Dextran 70Abciximab may increase the anticoagulant activities of Dextran 70.Approved
Dextran 75Abciximab may increase the anticoagulant activities of Dextran 75.Approved
DiclofenacDiclofenac may increase the anticoagulant activities of Abciximab.Approved, Vet Approved
DicoumarolAbciximab may increase the anticoagulant activities of Dicoumarol.Approved
DienestrolDienestrol may decrease the anticoagulant activities of Abciximab.Approved, Investigational
DienogestThe therapeutic efficacy of Abciximab can be decreased when used in combination with Dienogest.Approved
DiethylstilbestrolDiethylstilbestrol may decrease the anticoagulant activities of Abciximab.Approved, Investigational
DifenpiramideDifenpiramide may increase the anticoagulant activities of Abciximab.Experimental
DiflunisalThe risk or severity of adverse effects can be increased when Abciximab is combined with Diflunisal.Approved
DiphenadioneDiphenadione may increase the anticoagulant activities of Abciximab.Experimental
DipyridamoleDipyridamole may increase the anticoagulant activities of Abciximab.Approved
DitazoleDitazole may increase the anticoagulant activities of Abciximab.Approved, Withdrawn
Drotrecogin alfaDrotrecogin alfa may increase the anticoagulant activities of Abciximab.Approved, Investigational, Withdrawn
DroxicamDroxicam may increase the anticoagulant activities of Abciximab.Approved
DuvelisibDuvelisib may increase the anticoagulant activities of Abciximab.Investigational
DydrogesteroneThe therapeutic efficacy of Abciximab can be decreased when used in combination with Dydrogesterone.Approved, Investigational, Withdrawn
E-6201E-6201 may increase the anticoagulant activities of Abciximab.Investigational
Edetic AcidAbciximab may increase the anticoagulant activities of Edetic Acid.Approved, Vet Approved
EdoxabanEdoxaban may increase the anticoagulant activities of Abciximab.Approved
EnoxaparinAbciximab may increase the anticoagulant activities of Enoxaparin.Approved
EpimestrolEpimestrol may decrease the anticoagulant activities of Abciximab.Experimental
EpinastineEpinastine may increase the anticoagulant activities of Abciximab.Approved, Investigational
EpirizoleEpirizole may increase the anticoagulant activities of Abciximab.Approved
EplivanserinEplivanserin may increase the anticoagulant activities of Abciximab.Investigational
eplivanserineeplivanserine may increase the anticoagulant activities of Abciximab.Investigational
EpoprostenolEpoprostenol may increase the antiplatelet activities of Abciximab.Approved
EptifibatideEptifibatide may increase the anticoagulant activities of Abciximab.Approved, Investigational
EquolEquol may decrease the anticoagulant activities of Abciximab.Investigational
EstradiolEstradiol may decrease the anticoagulant activities of Abciximab.Approved, Investigational, Vet Approved
EstriolEstriol may decrease the anticoagulant activities of Abciximab.Approved, Investigational, Vet Approved
Estrogens, esterifiedEstrogens, esterified may decrease the anticoagulant activities of Abciximab.Approved
EstroneEstrone may decrease the anticoagulant activities of Abciximab.Approved
EtanerceptEtanercept may increase the anticoagulant activities of Abciximab.Approved, Investigational
EthenzamideEthenzamide may increase the anticoagulant activities of Abciximab.Experimental
Ethinyl EstradiolEthinyl Estradiol may decrease the anticoagulant activities of Abciximab.Approved
Ethyl biscoumacetateAbciximab may increase the anticoagulant activities of Ethyl biscoumacetate.Withdrawn
EthynodiolThe therapeutic efficacy of Abciximab can be decreased when used in combination with Ethynodiol.Experimental
EtodolacEtodolac may increase the anticoagulant activities of Abciximab.Approved, Investigational, Vet Approved
EtofenamateEtofenamate may increase the anticoagulant activities of Abciximab.Approved, Investigational
EtonogestrelThe therapeutic efficacy of Abciximab can be decreased when used in combination with Etonogestrel.Approved, Investigational
EtoricoxibEtoricoxib may increase the anticoagulant activities of Abciximab.Approved, Investigational
Evening primrose oilEvening primrose oil may increase the anticoagulant activities of Abciximab.Approved, Investigational
exisulindexisulind may increase the anticoagulant activities of Abciximab.Investigational
FelbinacFelbinac may increase the anticoagulant activities of Abciximab.Experimental
FenbufenFenbufen may increase the anticoagulant activities of Abciximab.Approved
FenoprofenFenoprofen may increase the anticoagulant activities of Abciximab.Approved
FentiazacFentiazac may increase the anticoagulant activities of Abciximab.Experimental
FeprazoneFeprazone may increase the anticoagulant activities of Abciximab.Experimental
Ferulic acidFerulic acid may increase the anticoagulant activities of Abciximab.Experimental
FibrinolysinFibrinolysin may increase the anticoagulant activities of Abciximab.Investigational
FloctafenineFloctafenine may increase the anticoagulant activities of Abciximab.Approved, Withdrawn
FluindioneAbciximab may increase the anticoagulant activities of Fluindione.Investigational
FlunixinFlunixin may increase the anticoagulant activities of Abciximab.Vet Approved
FlunoxaprofenFlunoxaprofen may increase the anticoagulant activities of Abciximab.Experimental
FlurbiprofenFlurbiprofen may increase the anticoagulant activities of Abciximab.Approved, Investigational
FondaparinuxAbciximab may increase the anticoagulant activities of Fondaparinux.Investigational
Fondaparinux sodiumAbciximab may increase the anticoagulant activities of Fondaparinux sodium.Approved, Investigational
G17DTThe therapeutic efficacy of G17DT can be decreased when used in combination with Abciximab.Investigational
GabexateAbciximab may increase the anticoagulant activities of Gabexate.Investigational
GenisteinGenistein may decrease the anticoagulant activities of Abciximab.Investigational
GestodeneThe therapeutic efficacy of Abciximab can be decreased when used in combination with Gestodene.Approved, Investigational
GestonoroneThe therapeutic efficacy of Abciximab can be decreased when used in combination with Gestonorone.Experimental
GestrinoneThe therapeutic efficacy of Abciximab can be decreased when used in combination with Gestrinone.Approved
GI-5005The therapeutic efficacy of GI-5005 can be decreased when used in combination with Abciximab.Investigational
GlucosamineGlucosamine may increase the antiplatelet activities of Abciximab.Approved
GuacetisalThe risk or severity of adverse effects can be increased when Abciximab is combined with Guacetisal.Experimental
HeminHemin may increase the anticoagulant activities of Abciximab.Approved
Hemoglobin crosfumarilThe risk or severity of adverse effects can be increased when Abciximab is combined with Hemoglobin crosfumaril.Experimental
HeparinAbciximab may increase the anticoagulant activities of Heparin.Approved, Investigational
Hepatitis A VaccineThe therapeutic efficacy of Hepatitis A Vaccine can be decreased when used in combination with Abciximab.Approved
Hepatitis B Vaccine (Recombinant)The therapeutic efficacy of Hepatitis B Vaccine (Recombinant) can be decreased when used in combination with Abciximab.Approved, Withdrawn
HexestrolHexestrol may decrease the anticoagulant activities of Abciximab.Withdrawn
HigenamineHigenamine may increase the anticoagulant activities of Abciximab.Investigational
Hydroxyprogesterone caproateThe therapeutic efficacy of Abciximab can be decreased when used in combination with Hydroxyprogesterone caproate.Approved
HydroxytyrosolHydroxytyrosol may increase the anticoagulant activities of Abciximab.Investigational
Ibritumomab tiuxetanThe risk or severity of adverse effects can be increased when Abciximab is combined with Ibritumomab tiuxetan.Approved
IbrutinibThe risk or severity of adverse effects can be increased when Ibrutinib is combined with Abciximab.Approved
IbudilastIbudilast may increase the anticoagulant activities of Abciximab.Approved, Investigational
IbuprofenIbuprofen may increase the anticoagulant activities of Abciximab.Approved
IbuproxamIbuproxam may increase the anticoagulant activities of Abciximab.Withdrawn
IcatibantIcatibant may increase the anticoagulant activities of Abciximab.Approved
Icosapent ethylIcosapent ethyl may increase the anticoagulant activities of Abciximab.Approved, Nutraceutical
IdraparinuxAbciximab may increase the anticoagulant activities of Idraparinux.Investigational
IfenprodilIfenprodil may increase the anticoagulant activities of Abciximab.Approved, Investigational, Withdrawn
IfetrobanIfetroban may increase the anticoagulant activities of Abciximab.Investigational
IloprostIloprost may increase the antiplatelet activities of Abciximab.Approved, Investigational
Imidazole salicylateImidazole salicylate may increase the anticoagulant activities of Abciximab.Experimental
IndobufenIndobufen may increase the anticoagulant activities of Abciximab.Investigational
IndomethacinIndomethacin may increase the anticoagulant activities of Abciximab.Approved, Investigational
IndoprofenIndoprofen may increase the anticoagulant activities of Abciximab.Withdrawn
INGN 201The therapeutic efficacy of INGN 201 can be decreased when used in combination with Abciximab.Investigational
INGN 225The therapeutic efficacy of INGN 225 can be decreased when used in combination with Abciximab.Investigational
IsoxicamIsoxicam may increase the anticoagulant activities of Abciximab.Withdrawn
KebuzoneKebuzone may increase the anticoagulant activities of Abciximab.Experimental
KetanserinKetanserin may increase the anticoagulant activities of Abciximab.Investigational
KetoprofenKetoprofen may increase the anticoagulant activities of Abciximab.Approved, Vet Approved
KetorolacKetorolac may increase the anticoagulant activities of Abciximab.Approved
LeflunomideLeflunomide may increase the anticoagulant activities of Abciximab.Approved, Investigational
LepirudinLepirudin may increase the anticoagulant activities of Abciximab.Approved
LetaxabanAbciximab may increase the anticoagulant activities of Letaxaban.Investigational
LevonorgestrelThe therapeutic efficacy of Abciximab can be decreased when used in combination with Levonorgestrel.Approved, Investigational
LimaprostThe risk or severity of adverse effects can be increased when Limaprost is combined with Abciximab.Approved, Investigational
LinsidomineLinsidomine may increase the anticoagulant activities of Abciximab.Experimental
LisofyllineLisofylline may increase the anticoagulant activities of Abciximab.Investigational
LonazolacLonazolac may increase the anticoagulant activities of Abciximab.Experimental
LornoxicamLornoxicam may increase the anticoagulant activities of Abciximab.Approved, Investigational
LoxoprofenLoxoprofen may increase the anticoagulant activities of Abciximab.Approved, Investigational
LumiracoxibLumiracoxib may increase the anticoagulant activities of Abciximab.Approved, Investigational
Magnesium salicylateMagnesium salicylate may increase the anticoagulant activities of Abciximab.Approved
MasoprocolMasoprocol may increase the anticoagulant activities of Abciximab.Approved, Investigational
Meclofenamic acidMeclofenamic acid may increase the anticoagulant activities of Abciximab.Approved, Vet Approved
MedrogestoneThe therapeutic efficacy of Abciximab can be decreased when used in combination with Medrogestone.Approved
Medroxyprogesterone acetateThe therapeutic efficacy of Abciximab can be decreased when used in combination with Medroxyprogesterone acetate.Approved, Investigational
Mefenamic acidMefenamic acid may increase the anticoagulant activities of Abciximab.Approved
Megestrol acetateThe therapeutic efficacy of Abciximab can be decreased when used in combination with Megestrol acetate.Approved, Vet Approved
MelagatranAbciximab may increase the anticoagulant activities of Melagatran.Experimental
MeloxicamMeloxicam may increase the anticoagulant activities of Abciximab.Approved, Vet Approved
MesalazineThe risk or severity of adverse effects can be increased when Abciximab is combined with Mesalazine.Approved
MestranolMestranol may decrease the anticoagulant activities of Abciximab.Approved
MetamizoleMetamizole may increase the anticoagulant activities of Abciximab.Investigational, Withdrawn
MethallenestrilMethallenestril may decrease the anticoagulant activities of Abciximab.Experimental
Methyl salicylateThe risk or severity of adverse effects can be increased when Abciximab is combined with Methyl salicylate.Approved, Vet Approved
MethylestrenoloneThe therapeutic efficacy of Abciximab can be decreased when used in combination with Methylestrenolone.Experimental
MilrinoneMilrinone may increase the anticoagulant activities of Abciximab.Approved
MizoribineMizoribine may increase the anticoagulant activities of Abciximab.Investigational
MofebutazoneMofebutazone may increase the anticoagulant activities of Abciximab.Experimental
MoxestrolMoxestrol may decrease the anticoagulant activities of Abciximab.Experimental
Mycophenolate mofetilMycophenolate mofetil may increase the anticoagulant activities of Abciximab.Approved, Investigational
Mycophenolic acidMycophenolic acid may increase the anticoagulant activities of Abciximab.Approved
NabumetoneNabumetone may increase the anticoagulant activities of Abciximab.Approved
NadroparinAbciximab may increase the anticoagulant activities of Nadroparin.Approved
NafamostatNafamostat may increase the anticoagulant activities of Abciximab.Approved, Investigational
NaftifineNaftifine may increase the anticoagulant activities of Abciximab.Approved
NaftopidilNaftopidil may increase the anticoagulant activities of Abciximab.Investigational
NaproxenNaproxen may increase the anticoagulant activities of Abciximab.Approved, Vet Approved
NepafenacNepafenac may increase the anticoagulant activities of Abciximab.Approved
NifenazoneNifenazone may increase the anticoagulant activities of Abciximab.Experimental
Niflumic AcidNiflumic Acid may increase the anticoagulant activities of Abciximab.Approved
NimesulideNimesulide may increase the anticoagulant activities of Abciximab.Approved, Investigational, Withdrawn
NintedanibThe risk or severity of adverse effects can be increased when Abciximab is combined with Nintedanib.Approved
NitroaspirinThe risk or severity of adverse effects can be increased when Abciximab is combined with Nitroaspirin.Investigational
NomegestrolThe therapeutic efficacy of Abciximab can be decreased when used in combination with Nomegestrol.Approved
NorethisteroneThe therapeutic efficacy of Abciximab can be decreased when used in combination with Norethisterone.Approved
NorgestrienoneThe therapeutic efficacy of Abciximab can be decreased when used in combination with Norgestrienone.Experimental
ObinutuzumabThe risk or severity of adverse effects can be increased when Abciximab is combined with Obinutuzumab.Approved
OlopatadineOlopatadine may increase the anticoagulant activities of Abciximab.Approved
OlsalazineOlsalazine may increase the anticoagulant activities of Abciximab.Approved
Omacetaxine mepesuccinateThe risk or severity of adverse effects can be increased when Abciximab is combined with Omacetaxine mepesuccinate.Approved
Omega-3 fatty acidsOmega-3 fatty acids may increase the anticoagulant activities of Abciximab.Approved, Nutraceutical
OrgoteinOrgotein may increase the anticoagulant activities of Abciximab.Vet Approved
OtamixabanAbciximab may increase the anticoagulant activities of Otamixaban.Investigational
OxaprozinOxaprozin may increase the anticoagulant activities of Abciximab.Approved
OxyphenbutazoneOxyphenbutazone may increase the anticoagulant activities of Abciximab.Approved, Withdrawn
OzagrelOzagrel may increase the anticoagulant activities of Abciximab.Investigational
ParecoxibParecoxib may increase the anticoagulant activities of Abciximab.Approved
ParnaparinParnaparin may increase the anticoagulant activities of Abciximab.Approved, Investigational
ParthenolideParthenolide may increase the anticoagulant activities of Abciximab.Investigational
Pentaerythritol TetranitrateAbciximab may increase the anticoagulant activities of Pentaerythritol Tetranitrate.Approved
Pentosan PolysulfatePentosan Polysulfate may increase the anticoagulant activities of Abciximab.Approved
PentoxifyllinePentoxifylline may increase the antiplatelet activities of Abciximab.Approved, Investigational
PhenindioneAbciximab may increase the anticoagulant activities of Phenindione.Approved, Investigational
PhenprocoumonAbciximab may increase the anticoagulant activities of Phenprocoumon.Approved, Investigational
PhenylbutazonePhenylbutazone may increase the anticoagulant activities of Abciximab.Approved, Vet Approved
PicotamidePicotamide may increase the anticoagulant activities of Abciximab.Experimental
PimecrolimusPimecrolimus may increase the anticoagulant activities of Abciximab.Approved, Investigational
PirfenidonePirfenidone may increase the anticoagulant activities of Abciximab.Approved, Investigational
PiroxicamPiroxicam may increase the anticoagulant activities of Abciximab.Approved, Investigational
PirprofenPirprofen may increase the anticoagulant activities of Abciximab.Experimental
Polyestradiol phosphatePolyestradiol phosphate may decrease the anticoagulant activities of Abciximab.Approved
PranoprofenPranoprofen may increase the anticoagulant activities of Abciximab.Experimental, Investigational
PrasugrelPrasugrel may increase the anticoagulant activities of Abciximab.Approved
ProgesteroneThe therapeutic efficacy of Abciximab can be decreased when used in combination with Progesterone.Approved, Vet Approved
ProglumetacinProglumetacin may increase the anticoagulant activities of Abciximab.Experimental
PromegestoneThe therapeutic efficacy of Abciximab can be decreased when used in combination with Promegestone.Experimental
PromestrienePromestriene may decrease the anticoagulant activities of Abciximab.Investigational
PropacetamolPropacetamol may increase the anticoagulant activities of Abciximab.Approved, Investigational
PropyphenazonePropyphenazone may increase the anticoagulant activities of Abciximab.Experimental
ProquazoneProquazone may increase the anticoagulant activities of Abciximab.Experimental
Protein CAbciximab may increase the anticoagulant activities of Protein C.Approved
Protein S humanAbciximab may increase the anticoagulant activities of Protein S human.Approved
ProtocatechualdehydeAbciximab may increase the anticoagulant activities of Protocatechualdehyde.Approved
PTC299PTC299 may increase the anticoagulant activities of Abciximab.Investigational
QuinestrolQuinestrol may decrease the anticoagulant activities of Abciximab.Approved
Rabies virus inactivated antigen, AThe therapeutic efficacy of Rabies virus inactivated antigen, A can be decreased when used in combination with Abciximab.Approved
RamatrobanRamatroban may increase the anticoagulant activities of Abciximab.Investigational
ResveratrolResveratrol may increase the anticoagulant activities of Abciximab.Approved, Experimental, Investigational
ReteplaseReteplase may increase the anticoagulant activities of Abciximab.Approved
ReviparinAbciximab may increase the anticoagulant activities of Reviparin.Approved, Investigational
RidogrelRidogrel may increase the anticoagulant activities of Abciximab.Approved
RindopepimutThe therapeutic efficacy of Rindopepimut can be decreased when used in combination with Abciximab.Investigational
RivaroxabanAbciximab may increase the anticoagulant activities of Rivaroxaban.Approved
RofecoxibRofecoxib may increase the anticoagulant activities of Abciximab.Investigational, Withdrawn
RosiglitazoneRosiglitazone may increase the anticoagulant activities of Abciximab.Approved, Investigational
Rotavirus VaccineThe therapeutic efficacy of Rotavirus Vaccine can be decreased when used in combination with Abciximab.Approved
Rubella virus vaccineThe therapeutic efficacy of Rubella virus vaccine can be decreased when used in combination with Abciximab.Approved
SalicylamideSalicylamide may increase the anticoagulant activities of Abciximab.Approved
Salicylic acidThe risk or severity of adverse effects can be increased when Abciximab is combined with Salicylic acid.Approved, Vet Approved
Salmonella typhi ty21a live antigenThe therapeutic efficacy of Salmonella typhi ty21a live antigen can be decreased when used in combination with Abciximab.Approved
SalsalateSalsalate may increase the anticoagulant activities of Abciximab.Approved
SarpogrelateSarpogrelate may increase the anticoagulant activities of Abciximab.Investigational
SaruplaseSaruplase may increase the anticoagulant activities of Abciximab.Experimental
SecoisolariciresinolSecoisolariciresinol may decrease the anticoagulant activities of Abciximab.Investigational
SelexipagSelexipag may increase the anticoagulant activities of Abciximab.Approved
SemapimodSemapimod may increase the anticoagulant activities of Abciximab.Investigational
SeratrodastSeratrodast may increase the anticoagulant activities of Abciximab.Approved
SerrapeptaseSerrapeptase may increase the anticoagulant activities of Abciximab.Investigational
SevofluraneSevoflurane may increase the anticoagulant activities of Abciximab.Approved, Vet Approved
SRP 299The therapeutic efficacy of SRP 299 can be decreased when used in combination with Abciximab.Investigational
SRT501SRT501 may increase the anticoagulant activities of Abciximab.Investigational
StreptokinaseStreptokinase may increase the anticoagulant activities of Abciximab.Approved, Investigational
SugammadexSugammadex may increase the anticoagulant activities of Abciximab.Approved
SulfasalazineSulfasalazine may increase the anticoagulant activities of Abciximab.Approved
SulindacSulindac may increase the anticoagulant activities of Abciximab.Approved
SulodexideAbciximab may increase the anticoagulant activities of Sulodexide.Approved, Investigational
SuprofenSuprofen may increase the anticoagulant activities of Abciximab.Approved, Withdrawn
SuxibuzoneSuxibuzone may increase the anticoagulant activities of Abciximab.Experimental
Synthetic Conjugated Estrogens, ASynthetic Conjugated Estrogens, A may decrease the anticoagulant activities of Abciximab.Approved
Synthetic Conjugated Estrogens, BSynthetic Conjugated Estrogens, B may decrease the anticoagulant activities of Abciximab.Approved
TarenflurbilTarenflurbil may increase the anticoagulant activities of Abciximab.Investigational
TecemotideThe therapeutic efficacy of Tecemotide can be decreased when used in combination with Abciximab.Investigational
TenecteplaseTenecteplase may increase the anticoagulant activities of Abciximab.Approved
TenidapTenidap may increase the anticoagulant activities of Abciximab.Experimental
TenoxicamTenoxicam may increase the anticoagulant activities of Abciximab.Approved
TepoxalinTepoxalin may increase the anticoagulant activities of Abciximab.Vet Approved
TeriflunomideTeriflunomide may increase the anticoagulant activities of Abciximab.Approved
TesmilifeneTesmilifene may increase the anticoagulant activities of Abciximab.Investigational
TG4010The therapeutic efficacy of TG4010 can be decreased when used in combination with Abciximab.Investigational
Tiaprofenic acidTiaprofenic acid may increase the anticoagulant activities of Abciximab.Approved
TiboloneTibolone may increase the anticoagulant activities of Abciximab.Approved, Investigational
TicagrelorTicagrelor may increase the anticoagulant activities of Abciximab.Approved
TiclopidineTiclopidine may increase the anticoagulant activities of Abciximab.Approved
TinoridineTinoridine may increase the anticoagulant activities of Abciximab.Investigational
TinzaparinTinzaparin may increase the anticoagulant activities of Abciximab.Approved
TioclomarolTioclomarol may increase the anticoagulant activities of Abciximab.Experimental
TipranavirTipranavir may increase the anticoagulant activities of Abciximab.Approved, Investigational
TirofibanTirofiban may increase the anticoagulant activities of Abciximab.Approved
Tolfenamic AcidTolfenamic Acid may increase the anticoagulant activities of Abciximab.Approved
TolmetinTolmetin may increase the anticoagulant activities of Abciximab.Approved
TositumomabThe risk or severity of adverse effects can be increased when Abciximab is combined with Tositumomab.Approved, Investigational
TranilastTranilast may increase the anticoagulant activities of Abciximab.Approved, Investigational
TrapidilTrapidil may increase the anticoagulant activities of Abciximab.Approved
TreprostinilTreprostinil may increase the antiplatelet activities of Abciximab.Approved, Investigational
TribenosideTribenoside may increase the anticoagulant activities of Abciximab.Experimental
TriflusalTriflusal may increase the anticoagulant activities of Abciximab.Approved, Investigational
TriptolideTriptolide may increase the anticoagulant activities of Abciximab.Investigational
Trolamine salicylateThe risk or severity of adverse effects can be increased when Abciximab is combined with Trolamine salicylate.Approved
TroxerutinAbciximab may increase the anticoagulant activities of Troxerutin.Investigational
UrokinaseUrokinase may increase the anticoagulant activities of Abciximab.Approved, Investigational, Withdrawn
ValdecoxibValdecoxib may increase the anticoagulant activities of Abciximab.Investigational, Withdrawn
Vitamin EVitamin E may increase the anticoagulant activities of Abciximab.Approved, Nutraceutical, Vet Approved
VorapaxarThe risk or severity of adverse effects can be increased when Vorapaxar is combined with Abciximab.Approved
WarfarinAbciximab may increase the anticoagulant activities of Warfarin.Approved
XimelagatranAbciximab may increase the anticoagulant activities of Ximelagatran.Approved, Investigational, Withdrawn
Yellow fever vaccineThe therapeutic efficacy of Yellow fever vaccine can be decreased when used in combination with Abciximab.Approved
ZaltoprofenZaltoprofen may increase the anticoagulant activities of Abciximab.Approved, Investigational
ZeranolZeranol may decrease the anticoagulant activities of Abciximab.Vet Approved
ZileutonZileuton may increase the anticoagulant activities of Abciximab.Approved, Investigational, Withdrawn
ZomepiracZomepirac may increase the anticoagulant activities of Abciximab.Withdrawn
Zoster vaccineThe therapeutic efficacy of Zoster vaccine can be decreased when used in combination with Abciximab.Approved
Food Interactions
Not Available

References

General References
  1. Authors unspecified: Use of a monoclonal antibody directed against the platelet glycoprotein IIb/IIIa receptor in high-risk coronary angioplasty. The EPIC Investigation. N Engl J Med. 1994 Apr 7;330(14):956-61. [PubMed:8121459]
  2. Tcheng JE, Kandzari DE, Grines CL, Cox DA, Effron MB, Garcia E, Griffin JJ, Guagliumi G, Stuckey T, Turco M, Fahy M, Lansky AJ, Mehran R, Stone GW: Benefits and risks of abciximab use in primary angioplasty for acute myocardial infarction: the Controlled Abciximab and Device Investigation to Lower Late Angioplasty Complications (CADILLAC) trial. Circulation. 2003 Sep 16;108(11):1316-23. Epub 2003 Aug 25. [PubMed:12939213]
External Links
KEGG Drug
D02778
PubChem Substance
46505910
ChEMBL
CHEMBL1201584
Therapeutic Targets Database
DAP000473
PharmGKB
PA448006
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Abciximab
ATC Codes
B01AC13 — Abciximab
AHFS Codes
  • 92:00.00 — Miscellaneous Therapeutic Agents
FDA label
Download (220 KB)
MSDS
Download (19.7 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
1, 2WithdrawnNot AvailableCarotid Stenosis1
2Active Not RecruitingOtherAcute Myocardial Infarction (AMI)1
2CompletedTreatmentCerebrovascular Accidents2
2CompletedTreatmentNon ST Segment Elevation Myocardial Infarction (NSTEMI) / Stable Angina (Associated With High Risk PCI) / Unstable Angina (UA)1
2Unknown StatusPreventionPatients Above 18 Years1
2WithdrawnTreatmentHb-SS Disease With Vasoocclusive Pain / Hemoglobin SS Disease With Crisis / Hemoglobin SS Disease With Vasoocclusive Crisis / Other Sickle Cell Disease With Vaso-Occlusive Pain / Sickle Cell Disorders1
2, 3Unknown StatusPreventionArterial Occlusive Diseases1
3CompletedTreatmentAngioplasty, Transluminal, Percutaneous Coronary1
3CompletedTreatmentAngioplasty, Transluminal, Percutaneous Coronary / Unstable Angina (UA)2
3CompletedTreatmentMyocardial Infarction (MI)2
3TerminatedTreatmentAcute Disease / Cerebrovascular Accidents / Ischemia, Brain1
3TerminatedTreatmentAcute Myocardial Infarction (AMI)1
3TerminatedTreatmentStenosis / Strokes1
3TerminatedTreatmentStrokes1
3Unknown StatusTreatmentMyocardial Infarction (MI)1
4CompletedNot AvailableCoronary Artery Disease1
4CompletedTreatmentAcute Myocardial Infarction (AMI)2
4CompletedTreatmentAngina Pectoris / Coronary Heart Disease (CHD)1
4CompletedTreatmentCoronary Artery Disease / Transient ischemia attacks1
4CompletedTreatmentCoronary Heart Disease (CHD) / Myocardial Infarction (MI)1
4CompletedTreatmentCoronary Heart Disease (CHD) / Unstable Angina (UA)1
4CompletedTreatmentDiabetes Mellitus (DM)1
4CompletedTreatmentMyocardial Infarction (MI)3
4CompletedTreatmentMyocardial Infarction (MI) / Transient ischemia attacks2
4CompletedTreatmentShock, Cardiogenic1
4TerminatedNot AvailableCoronary Heart Disease (CHD) / Myocardial Infarction (MI)1
4Unknown StatusTreatmentAngioplasty / Myocardial Infarction (MI)1
4Unknown StatusTreatmentPrimary Percutaneous Coronary Intervention / ST Elevation Myocardial Infarction (STEMI)1
4Unknown StatusTreatmentST Elevation Myocardial Infarction (STEMI)1
Not AvailableCompletedTreatmentAtherosclerosis / Ischaemic Heart Diseases1
Not AvailableCompletedTreatmentStable Angina (SA)1
Not AvailableUnknown StatusTreatmentCoronary Artery Disease / Myocardial Infarction (MI)1
Not AvailableUnknown StatusTreatmentST Elevation Myocardial Infarction (STEMI)1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
Dosage forms
FormRouteStrength
Injection, solutionIntravenous2 mg/mL
SolutionIntravenous2 mg
Prices
Unit descriptionCostUnit
Reopro 2 mg/ml vial155.77USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA1341357No2002-05-072019-05-07Canada

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.424Not Available
isoelectric point6.16Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antagonist
General Function
Virus receptor activity
Specific Function
Integrin alpha-V/beta-3 (ITGAV:ITGB3) is a receptor for cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin and von Wil...
Gene Name
ITGB3
Uniprot ID
P05106
Uniprot Name
Integrin beta-3
Molecular Weight
87056.975 Da
References
  1. Amoroso G, van Boven AJ, van Veldhuisen DJ, Tio RA, Balje-Volkers CP, Petronio AS, van Oeveren W: Eptifibatide and abciximab exhibit equivalent antiplatelet efficacy in an experimental model of stenting in both healthy volunteers and patients with coronary artery disease. J Cardiovasc Pharmacol. 2001 Oct;38(4):633-41. [PubMed:11588534]
  2. Weber AA, Meila D, Jacobs C, Weber S, Kelm M, Strauer BE, Zotz RB, Scharf RE, Schror K: Low incidence of paradoxical platelet activation by glycoprotein IIb/IIIa inhibitors. Thromb Res. 2002 Apr 1;106(1):25-9. [PubMed:12165285]
  3. Hall PR, Malone L, Sillerud LO, Ye C, Hjelle BL, Larson RS: Characterization and NMR solution structure of a novel cyclic pentapeptide inhibitor of pathogenic hantaviruses. Chem Biol Drug Des. 2007 Mar;69(3):180-90. [PubMed:17441904]
  4. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
  5. Mazzaferri EL Jr, Young JJ: Abciximab: a review and update for clinicians. Expert Rev Cardiovasc Ther. 2008 Jun;6(5):609-18. doi: 10.1586/14779072.6.5.609. [PubMed:18510478]
  6. Ibbotson T, McGavin JK, Goa KL: Abciximab: an updated review of its therapeutic use in patients with ischaemic heart disease undergoing percutaneous coronary revascularisation. Drugs. 2003;63(11):1121-63. [PubMed:12749745]
Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antagonist
General Function
Metal ion binding
Specific Function
Integrin alpha-IIb/beta-3 is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. It recognizes the sequence R-G-D in a wide array of ligands. It recogn...
Gene Name
ITGA2B
Uniprot ID
P08514
Uniprot Name
Integrin alpha-IIb
Molecular Weight
113375.96 Da
References
  1. Gibbs NM: Point-of-care assessment of antiplatelet agents in the perioperative period: a review. Anaesth Intensive Care. 2009 May;37(3):354-69. [PubMed:19499855]
  2. Mazzaferri EL Jr, Young JJ: Abciximab: a review and update for clinicians. Expert Rev Cardiovasc Ther. 2008 Jun;6(5):609-18. doi: 10.1586/14779072.6.5.609. [PubMed:18510478]
  3. Ibbotson T, McGavin JK, Goa KL: Abciximab: an updated review of its therapeutic use in patients with ischaemic heart disease undergoing percutaneous coronary revascularisation. Drugs. 2003;63(11):1121-63. [PubMed:12749745]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent...
Gene Name
FCGR3B
Uniprot ID
O75015
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-B
Molecular Weight
26215.64 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type peptidase activity
Specific Function
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name
C1R
Uniprot ID
P00736
Uniprot Name
Complement C1r subcomponent
Molecular Weight
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QA
Uniprot ID
P02745
Uniprot Name
Complement C1q subcomponent subunit A
Molecular Weight
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QB
Uniprot ID
P02746
Uniprot Name
Complement C1q subcomponent subunit B
Molecular Weight
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QC
Uniprot ID
P02747
Uniprot Name
Complement C1q subcomponent subunit C
Molecular Weight
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as...
Gene Name
FCGR3A
Uniprot ID
P08637
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-A
Molecular Weight
29088.895 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type endopeptidase activity
Specific Function
C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activat...
Gene Name
C1S
Uniprot ID
P09871
Uniprot Name
Complement C1s subcomponent
Molecular Weight
76683.905 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Receptor signaling protein activity
Specific Function
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name
FCGR1A
Uniprot ID
P12314
Uniprot Name
High affinity immunoglobulin gamma Fc receptor I
Molecular Weight
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized ...
Gene Name
FCGR2A
Uniprot ID
P12318
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-a
Molecular Weight
35000.42 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complex...
Gene Name
FCGR2B
Uniprot ID
P31994
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-b
Molecular Weight
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Transmembrane signaling receptor activity
Specific Function
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulat...
Gene Name
FCGR2C
Uniprot ID
P31995
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-c
Molecular Weight
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Scavenger receptor activity
Specific Function
Vitronectin is a cell adhesion and spreading factor found in serum and tissues. Vitronectin interact with glycosaminoglycans and proteoglycans. Is recognized by certain members of the integrin fami...
Gene Name
VTN
Uniprot ID
P04004
Uniprot Name
Vitronectin
Molecular Weight
54305.135 Da
References
  1. Romagnoli E, Burzotta F, Trani C, Biondi-Zoccai GG, Giannico F, Crea F: Rationale for intracoronary administration of abciximab. J Thromb Thrombolysis. 2007 Feb;23(1):57-63. [PubMed:17160551]
  2. Ibbotson T, McGavin JK, Goa KL: Abciximab: an updated review of its therapeutic use in patients with ischaemic heart disease undergoing percutaneous coronary revascularisation. Drugs. 2003;63(11):1121-63. [PubMed:12749745]

Drug created on June 13, 2005 07:24 / Updated on November 19, 2017 20:34