Identification
NameAdalimumab
Accession NumberDB00051  (BTD00049, BIOD00049)
TypeBiotech
GroupsApproved
Description

Adalimumab is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system. It consists of 1330 amino acids and has a molecular weight of approximately 148 kilodaltons.

Protein structureDb00051
Related Articles
Protein chemical formulaC6428H9912N1694O1987S46
Protein average weight144190.3 Da
Sequences
> Light chain:
DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPS
RFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
> Heavy chain:
EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDY
ADSVEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Download FASTA Format
SynonymsNot Available
External IDs Not Available
Product Ingredients Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
HumiraKitAbbvie2002-12-31Not applicableUs
HumiraInjection, solution40 mgSubcutaneousAbbvie2003-09-08Not applicableEu
HumiraKitAbbvie2016-03-09Not applicableUs
HumiraInjection, solution40 mgSubcutaneousAbbvie2003-09-08Not applicableEu
HumiraInjection, solution40 mgSubcutaneousAbbvie2003-09-08Not applicableEu
HumiraSolution40 mgSubcutaneousAbbvie2016-11-14Not applicableCanada
HumiraSolution40 mgSubcutaneousAbbvie2004-09-24Not applicableCanada
HumiraInjection, solution40 mgSubcutaneousAbbvie2003-09-08Not applicableEu
HumiraInjection, solution40 mgSubcutaneousAbbvie2003-09-08Not applicableEu
HumiraKitAbbvie2002-12-31Not applicableUs
HumiraInjection, solution40 mgSubcutaneousAbbvie2003-09-08Not applicableEu
HumiraInjection, solution40 mgSubcutaneousAbbvie2003-09-08Not applicableEu
HumiraKitAbbvie2017-04-28Not applicableUs
HumiraKitAbbvie2002-12-31Not applicableUs
HumiraSolution40 mgSubcutaneousAbbvie2016-11-14Not applicableCanada
HumiraKitAbbvie2002-12-23Not applicableUs
HumiraInjection, solution40 mgSubcutaneousAbbvie2003-09-08Not applicableEu
HumiraKitAbbvie2016-10-17Not applicableUs
HumiraInjection, solution40 mgSubcutaneousAbbvie2003-09-08Not applicableEu
HumiraInjection, solution40 mgSubcutaneousAbbvie2003-09-08Not applicableEu
HumiraInjection, solution40 mgSubcutaneousAbbvie2003-09-08Not applicableEu
HumiraKitAbbvie2017-04-21Not applicableUs
HumiraInjection, solution40 mgSubcutaneousAbbvie2003-09-08Not applicableEu
HumiraInjection, solution40 mg/.8mLSubcutaneousAbbvie2002-12-30Not applicableUs
HumiraInjection, solution40 mgSubcutaneousAbbvie2003-09-08Not applicableEu
HumiraKitAbbvie2017-04-21Not applicableUs
HumiraInjection, solution40 mgSubcutaneousAbbvie2003-09-08Not applicableEu
HumiraInjection, solution40 mgSubcutaneousAbbvie2003-09-08Not applicableEu
HumiraKitAbbvie2002-12-31Not applicableUs
HumiraInjection, solution40 mgSubcutaneousAbbvie2003-09-08Not applicableEu
HumiraKitAbbvie2016-10-17Not applicableUs
HumiraInjection, solution40 mgSubcutaneousAbbvie2003-09-08Not applicableEu
HumiraKitAbbvie2017-04-28Not applicableUs
HumiraInjection, solution40 mgSubcutaneousAbbvie2003-09-08Not applicableEu
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International Brands
NameCompany
Humira PenAbbott Laboratories
Brand mixturesNot Available
Categories
UNIIFYS6T7F842
CAS number331731-18-1
Pharmacology
Indication

For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.

Structured Indications
Pharmacodynamics

Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.

Mechanism of action

Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.

TargetKindPharmacological actionActionsOrganismUniProt ID
Tumor necrosis factorProteinyes
antibody
HumanP01375 details
Low affinity immunoglobulin gamma Fc region receptor III-BProteinunknownNot AvailableHumanO75015 details
Complement C1r subcomponentProteinunknownNot AvailableHumanP00736 details
Complement C1q subcomponent subunit AProteinunknownNot AvailableHumanP02745 details
Complement C1q subcomponent subunit BProteinunknownNot AvailableHumanP02746 details
Complement C1q subcomponent subunit CProteinunknownNot AvailableHumanP02747 details
Low affinity immunoglobulin gamma Fc region receptor III-AProteinunknownNot AvailableHumanP08637 details
Complement C1s subcomponentProteinunknownNot AvailableHumanP09871 details
High affinity immunoglobulin gamma Fc receptor IProteinunknownNot AvailableHumanP12314 details
Low affinity immunoglobulin gamma Fc region receptor II-aProteinunknownNot AvailableHumanP12318 details
Low affinity immunoglobulin gamma Fc region receptor II-bProteinunknownNot AvailableHumanP31994 details
Low affinity immunoglobulin gamma Fc region receptor II-cProteinunknownNot AvailableHumanP31995 details
Related Articles
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system.

Route of eliminationNot Available
Half life

10-20 days.

Clearance
  • 12 mL/hr [RA patients with dose 0.25-10 mg/kg]
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
Pharmacogenomic Effects/ADRs Not Available
Interactions
Drug Interactions
DrugInteractionDrug group
AbataceptThe risk or severity of adverse effects can be increased when Adalimumab is combined with Abatacept.Approved
Ambroxol acefyllinateThe serum concentration of Ambroxol acefyllinate can be decreased when it is combined with Adalimumab.Experimental
AminophyllineThe serum concentration of Aminophylline can be decreased when it is combined with Adalimumab.Approved
AnakinraThe risk or severity of adverse effects can be increased when Adalimumab is combined with Anakinra.Approved
BelimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Belimumab.Approved
CanakinumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Canakinumab.Approved, Investigational
Certolizumab pegolAdalimumab may increase the immunosuppressive activities of Certolizumab pegol.Approved
CyclosporineThe serum concentration of Cyclosporine can be decreased when it is combined with Adalimumab.Approved, Investigational, Vet Approved
DenosumabThe risk or severity of adverse effects can be increased when Denosumab is combined with Adalimumab.Approved
DyphyllineThe serum concentration of Dyphylline can be decreased when it is combined with Adalimumab.Approved
EtanerceptThe risk or severity of adverse effects can be increased when Adalimumab is combined with Etanercept.Approved, Investigational
FingolimodAdalimumab may increase the immunosuppressive activities of Fingolimod.Approved, Investigational
G17DTThe risk or severity of adverse effects can be increased when Adalimumab is combined with G17DT.Investigational
GolimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Golimumab.Approved
InfliximabAdalimumab may increase the immunosuppressive activities of Infliximab.Approved
INGN 201The risk or severity of adverse effects can be increased when Adalimumab is combined with INGN 201.Investigational
INGN 225The risk or severity of adverse effects can be increased when Adalimumab is combined with INGN 225.Investigational
LeflunomideThe risk or severity of adverse effects can be increased when Adalimumab is combined with Leflunomide.Approved, Investigational
NatalizumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Natalizumab.Approved, Investigational
PimecrolimusThe risk or severity of adverse effects can be increased when Pimecrolimus is combined with Adalimumab.Approved, Investigational
RilonaceptThe risk or severity of adverse effects can be increased when Adalimumab is combined with Rilonacept.Approved
RindopepimutThe risk or severity of adverse effects can be increased when Adalimumab is combined with CDX-110.Investigational
RituximabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Rituximab.Approved
RoflumilastRoflumilast may increase the immunosuppressive activities of Adalimumab.Approved
Sipuleucel-TThe therapeutic efficacy of Sipuleucel-T can be decreased when used in combination with Adalimumab.Approved
SRP 299The risk or severity of adverse effects can be increased when Adalimumab is combined with SRP 299.Investigational
TacrolimusThe risk or severity of adverse effects can be increased when Tacrolimus is combined with Adalimumab.Approved, Investigational
TheophyllineThe serum concentration of Theophylline can be decreased when it is combined with Adalimumab.Approved
TocilizumabTocilizumab may increase the immunosuppressive activities of Adalimumab.Approved
TofacitinibThe risk or severity of adverse effects can be increased when Adalimumab is combined with Tofacitinib.Approved, Investigational
TrastuzumabTrastuzumab may increase the neutropenic activities of Adalimumab.Approved, Investigational
VedolizumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Vedolizumab.Approved
WarfarinThe serum concentration of Warfarin can be decreased when it is combined with Adalimumab.Approved
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Link [Link]
  2. Link [Link]
External Links
ATC CodesL04AB04
AHFS Codes
  • 92:00.00
PDB Entries
FDA labelNot Available
MSDSNot Available
Clinical Trials
Clinical Trials
PhaseStatusPurposeConditionsCount
0CompletedBasic ScienceInnate Immunity1
1CompletedNot AvailableHealthy Volunteers1
1CompletedBasic ScienceHealthy Volunteers1
1CompletedHealth Services ResearchHealthy Volunteers1
1CompletedOtherHealthy Volunteers1
1CompletedTreatmentGlomerulosclerosis, Focal Segmental1
1CompletedTreatmentHealthy Volunteers2
1CompletedTreatmentPsoriasis1
1CompletedTreatmentRheumatoid Arthritis1
1CompletedTreatmentUlcerative Colitis (UC)1
1Enrolling by InvitationTreatmentHealthy Volunteers1
1Not Yet RecruitingTreatmentHealthy Volunteers1
1Unknown StatusTreatmentRetinopathy, Diabetic / Subfoveal Choroidal Neovascularization / Uveitis1
1WithdrawnTreatmentAnaplastic Thyroid Cancers1
1, 2CompletedTreatmentSynovitis of osteoarthritis1
1, 2Not Yet RecruitingTreatmentMucopolysaccharidosis II / Type 1 Mucopolysaccharidosis1
1, 2TerminatedTreatmentPsoriasis1
2Active Not RecruitingTreatmentNetherton Syndrome1
2CompletedNot AvailableChronic Plaque Psoriasis1
2CompletedTreatmentAge-Related Macular Degeneration (ARMD) / Subfoveal Choroidal Neovascularization1
2CompletedTreatmentArthritis / Psoriatic1
2CompletedTreatmentCrohn's Disease (CD)2
2CompletedTreatmentErosive Osteo-Arthritis1
2CompletedTreatmentGlomerulosclerosis, Focal Segmental1
2CompletedTreatmentHidradenitis Suppurativa (HS)2
2CompletedTreatmentPsoriasis5
2CompletedTreatmentPsoriatic Arthritis1
2CompletedTreatmentRheumatoid Arthritis11
2CompletedTreatmentSarcoidosis1
2CompletedTreatmentSciatica1
2CompletedTreatmentUveitis1
2CompletedTreatmentSynovitis of osteoarthritis1
2Not Yet RecruitingTreatmentBiotherapy / Uveitis1
2RecruitingTreatmentAnkylosing Spondylitis (AS)1
2RecruitingTreatmentDupuytren's Disease1
2RecruitingTreatmentNon-Infectious Uveitis / Uveitis1
2RecruitingTreatmentOsteoarthritis of the Knees1
2RecruitingTreatmentRheumatoid Arthritis1
2TerminatedTreatmentRheumatoid Arthritis3
2TerminatedTreatmentSarcoidosis1
2WithdrawnTreatmentAsthma Bronchial1
2WithdrawnTreatmentColitis / Cytokines / Drug Evaluation / Hermanski-Pudlak Syndrome / Lymphocytes1
2WithdrawnTreatmentCutaneous Sarcoidosis / Sarcoidosis1
2WithdrawnTreatmentInflammatory Reaction / Rheumatoid Arthritis1
2WithdrawnTreatmentPyoderma Gangrenosum2
2WithdrawnTreatmentSarcoidosis1
2, 3CompletedTreatmentCrohn's Disease (CD)2
2, 3CompletedTreatmentJuvenile Idiopathic Arthritis (JIA) / Uveitis1
2, 3CompletedTreatmentPsoriasis1
2, 3CompletedTreatmentRheumatoid Arthritis2
2, 3RecruitingTreatmentMucopolysaccharidosis Type I / Mucopolysaccharidosis Type II / Mucopolysaccharidosis Type VI1
2, 3Unknown StatusTreatmentUveitis1
3Active Not RecruitingTreatmentAdalimumab / Generalized Pustular Psoriasis (GPP) / Japanese1
3Active Not RecruitingTreatmentChronic Plaque Psoriasis / Psoriasis1
3Active Not RecruitingTreatmentCrohn's Disease (CD)1
3Active Not RecruitingTreatmentModerate to Severe Plaque Psoriasis / Plaque Type Psoriasis / Psoriasis1
3Active Not RecruitingTreatmentModerate to Severe Rheumatoid Arthritis1
3Active Not RecruitingTreatmentPsoriasis3
3Active Not RecruitingTreatmentPsoriasis, Arthritic1
3Active Not RecruitingTreatmentRheumatoid Arthritis4
3Active Not RecruitingTreatmentUveitis1
3CompletedTreatmentActive Rheumatoid Arthritis1
3CompletedTreatmentAnkylosing Spondylitis (AS)5
3CompletedTreatmentArthritis, Juvenile Rheumatoid1
3CompletedTreatmentArthritis; Behcet1
3CompletedTreatmentArthritis / Psoriatic1
3CompletedTreatmentChronic Plaque Psoriasis1
3CompletedTreatmentCrohn's Disease (CD)14
3CompletedTreatmentCrohn's Disease With Perianal Fistulas1
3CompletedTreatmentEarly Rheumatoid Arthritis2
3CompletedTreatmentEnthesitis Related Arthritis (ERA)1
3CompletedTreatmentGiant Cells Arteritis1
3CompletedTreatmentHidradenitis Suppurativa (HS)3
3CompletedTreatmentInterstitial Cystitis1
3CompletedTreatmentIntestinal Behçet's Disease1
3CompletedTreatmentJuvenile Idiopathic Arthritis (JIA)2
3CompletedTreatmentNail Psoriasis / Plaque Psoriasis1
3CompletedTreatmentPeripheral Spondyloarthritis1
3CompletedTreatmentPlaque Psoriasis3
3CompletedTreatmentPouchitis / Ulcerative Colitis (UC)1
3CompletedTreatmentPsoriasis7
3CompletedTreatmentPsoriasis / Psoriatic Arthritis1
3CompletedTreatmentPsoriatic Arthritis3
3CompletedTreatmentRheumatoid Arthritis23
3CompletedTreatmentSpondyloarthritis, Axial1
3CompletedTreatmentUlcerative Colitis (UC)5
3CompletedTreatmentUveitis2
3Enrolling by InvitationTreatmentPsoriatic Arthritis1
3Enrolling by InvitationTreatmentUlcerative Colitis (UC)1
3Not Yet RecruitingTreatmentAS1
3Not Yet RecruitingTreatmentPsoriatic Arthritis1
3RecruitingTreatmentCrohn's Disease (CD)4
3RecruitingTreatmentHidradenitis Suppurativa (HS)1
3RecruitingTreatmentJuvenile Idiopathic Arthritis (JIA)1
3RecruitingTreatmentPsoriasis2
3RecruitingTreatmentRheumatoid Arthritis4
3RecruitingTreatmentSpondyloarthritis1
3RecruitingTreatmentUlcerative Colitis (UC)5
3TerminatedTreatmentCrohn's Disease (CD) / Mucosal Inflammation1
3TerminatedTreatmentRheumatoid Arthritis1
3Unknown StatusPreventionCrohn's Disease (CD)1
3Unknown StatusTreatmentUlcerative Colitis (UC)1
3WithdrawnTreatmentAnkylosing Spondylitis (AS)1
3WithdrawnTreatmentCrohn's Disease (CD)1
4Active Not RecruitingBasic SciencePsoriasis1
4Active Not RecruitingPreventionCardiovascular Disease (CVD) / Rheumatoid Arthritis1
4Active Not RecruitingTreatmentAnkylosing Spondylitis (AS)1
4Active Not RecruitingTreatmentCardiovascular Disease (CVD) / Psoriasis1
4CompletedNot AvailableRheumatoid Arthritis3
4CompletedDiagnosticEnterocolitis / Spondyloarthritis1
4CompletedPreventionCoronary Artery Atherosclerosis / Psoriasis / Vascular Inflammation2
4CompletedTreatmentAnkylosing Spondylitis (AS)1
4CompletedTreatmentAnkylosing Spondylitis (AS) / Psoriatic Arthritis / Spondylarthropathy1
4CompletedTreatmentArthritis / Joint Diseases / Rheumatoid Arthritis1
4CompletedTreatmentCardiovascular Disease (CVD) / Psoriasis1
4CompletedTreatmentCrohn's Disease (CD) / Plaque Psoriasis1
4CompletedTreatmentModerate to Severe Crohn's Disease1
4CompletedTreatmentModerate to Severe Plaque Psoriasis1
4CompletedTreatmentPsoriasis2
4CompletedTreatmentPsoriasis / Sleep Apnea, Obstructive1
4CompletedTreatmentPsoriatic Arthritis1
4CompletedTreatmentRheumatoid Arthritis13
4CompletedTreatmentSpondyloarthritis1
4CompletedTreatmentSpondyloarthritis, Axial1
4Enrolling by InvitationBasic ScienceRheumatoid Arthritis1
4Enrolling by InvitationTreatmentUlcerative Colitis (UC)1
4Not Yet RecruitingTreatmentCrohn's Disease (CD)2
4Not Yet RecruitingTreatmentCrohn's Disease (CD) / Ulcerative Colitis (UC)1
4Not Yet RecruitingTreatmentPsoriatic Arthritis1
4Not Yet RecruitingTreatmentRheumatoid Arthritis1
4RecruitingBasic ScienceRheumatoid Arthritis3
4RecruitingTreatmentAnkylosing Spondylitis (AS)1
4RecruitingTreatmentAnkylosing Spondyloarthritis1
4RecruitingTreatmentCrohn's Disease (CD)1
4RecruitingTreatmentHidradenitis Suppurativa (HS)1
4RecruitingTreatmentMusculoskeletal and Connective Tissue Diseases / Rheumatoid Arthritis1
4RecruitingTreatmentPsoriatic Arthritis1
4RecruitingTreatmentRheumatoid Arthritis6
4RecruitingTreatmentRheumatoid Arthritis / Targeted Ultrasound1
4RecruitingTreatmentSpondyloarthritis, Axial1
4TerminatedTreatmentRheumatoid Arthritis4
4Unknown StatusNot AvailableRheumatoid Arthritis1
4Unknown StatusBasic ScienceAbsolute Number, Density of Immune Infiltrate and Dendritic Cells and Inflammatory Cytokines Expression Pattern / Psoriasis, Moderate to Severe1
4Unknown StatusPreventionCardiovascular Disease (CVD) / Psoriasis / Type 2 Diabetes Mellitus1
4Unknown StatusScreeningAnkylosing Spondylitis (AS) / Rheumatoid Arthritis1
4Unknown StatusTreatmentAnkylosing Spondylitis (AS) / Hypertensive / Psoriatic Arthritis / Rheumatoid Arthritis1
4Unknown StatusTreatmentArthritis / Rheumatoid Arthritis1
4Unknown StatusTreatmentRheumatoid Arthritis3
4Unknown StatusTreatmentSpondyloarthritis1
4WithdrawnTreatmentCrohn's Disease (CD) / Spondyloarthritis1
Not AvailableActive Not RecruitingNot AvailableInflammatory Reaction / Psoriasis1
Not AvailableActive Not RecruitingNot AvailableJIA / Juvenile Idiopathic Arthritis (JIA)1
Not AvailableActive Not RecruitingOtherCrohn's Disease (CD)1
Not AvailableApproved for MarketingNot AvailableRheumatoid Arthritis3
Not AvailableCompletedNot AvailableAnkylosing Spondylitis (AS) / Psoriatic Arthritis / Rheumatoid Arthritis1
Not AvailableCompletedNot AvailableAtherosclerosis / Moderate, refractory Atopic dermatitis / Psoriasis1
Not AvailableCompletedNot AvailableCrohn's Disease (CD) / Inflammatory Bowel Diseases (IBD) / Ulcerative Colitis (UC)1
Not AvailableCompletedNot AvailableInflammatory Bowel Diseases (IBD) / Psoriasis1
Not AvailableCompletedNot AvailablePsoriasis1
Not AvailableCompletedNot AvailablePsoriatic Arthritis1
Not AvailableCompletedNot AvailableRheumatoid Arthritis3
Not AvailableCompletedNot AvailableSpondyloarthritis / Ultrasonography1
Not AvailableCompletedBasic ScienceRheumatoid Arthritis1
Not AvailableCompletedTreatmentPsoriasis1
Not AvailableCompletedTreatmentRheumatoid Arthritis1
Not AvailableNot Yet RecruitingTreatmentUlcerative Colitis (UC)1
Not AvailableRecruitingNot AvailableAnkylosing Spondylitis (AS) / Psoriatic Arthritis / Rheumatoid Arthritis1
Not AvailableRecruitingNot AvailableCrohn's Disease (CD)1
Not AvailableRecruitingNot AvailableCrohn's Disease (CD) / Inflammatory Bowel Diseases (IBD)1
Not AvailableRecruitingNot AvailableHidradenitis Suppurativa (HS)1
Not AvailableRecruitingNot AvailableInflammatory Bowel Diseases (IBD)1
Not AvailableRecruitingNot AvailablePsoriasis1
Not AvailableRecruitingNot AvailableRheumatoid Arthritis4
Not AvailableRecruitingBasic SciencePain / Rheumatoid Arthritis / Tiredness1
Not AvailableUnknown StatusNot AvailableCrohn's Disease (CD)1
Not AvailableUnknown StatusNot AvailableScleritis / Uveitis1
Not AvailableUnknown StatusTreatmentCrohn's Disease (CD)1
Not AvailableUnknown StatusTreatmentPsoriasis1
Not AvailableWithdrawnNot AvailablePsoriatic Arthritis1
Not AvailableWithdrawnNot AvailableRheumatoid Arthritis1
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Injection, solutionSubcutaneous40 mg
Injection, solutionSubcutaneous40 mg/.8mL
Kit
SolutionSubcutaneous40 mg
Prices
Unit descriptionCostUnit
Humira (1 Box = Two 40 mg/0.8ml Syringes) Box1995.1USD box
Humira 2 20 mg/0.4ml Kit 1 Box = Two 20 mg/0.4ml Syringes1995.1USD box
Humira Pen 2 40 mg/0.8ml Kit (1 Box = 1 Kit Containing Two 40 mg/0.8ml Pens)1995.1USD box
Humira 20 mg/0.4 ml syringe959.19USD syringe
Humira 40 mg/0.8 ml pen959.19USD pen
Humira crohn's starter pack959.19USD each
Humira psoriasis starter pack959.19USD each
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2243459 No2002-09-172017-02-10Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.441Not Available
isoelectric point8.25Not Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
antibody
General Function:
Tumor necrosis factor receptor binding
Specific Function:
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs ...
Gene Name:
TNF
Uniprot ID:
P01375
Molecular Weight:
25644.15 Da
References
  1. Lorenz HM: Technology evaluation: adalimumab, Abbott laboratories. Curr Opin Mol Ther. 2002 Apr;4(2):185-90. [PubMed:12044041 ]
  2. Flendrie M, Creemers MC, Welsing PM, den Broeder AA, van Riel PL: Survival during treatment with tumour necrosis factor blocking agents in rheumatoid arthritis. Ann Rheum Dis. 2003 Nov;62 Suppl 2:ii30-3. [PubMed:14532145 ]
  3. Aguillon JC, Contreras J, Dotte A, Cruzat A, Catalan D, Salazar L, Molina MC, Guerrero J, Lopez M, Soto L, Salazar-Onfray F, Cuchacovich M: [New immunological weapons for medicine in the 21st Century: biological therapy based on the use of the latest generation monoclonal antibodies]. Rev Med Chil. 2003 Dec;131(12):1445-53. [PubMed:15022409 ]
  4. Bang LM, Keating GM: Adalimumab: a review of its use in rheumatoid arthritis. BioDrugs. 2004;18(2):121-39. [PubMed:15046527 ]
  5. Klinkhoff A: Biological agents for rheumatoid arthritis: targeting both physical function and structural damage. Drugs. 2004;64(12):1267-83. [PubMed:15200343 ]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Gene Name:
FCGR3B
Uniprot ID:
O75015
Molecular Weight:
26215.64 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type peptidase activity
Specific Function:
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name:
C1R
Uniprot ID:
P00736
Molecular Weight:
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QA
Uniprot ID:
P02745
Molecular Weight:
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QB
Uniprot ID:
P02746
Molecular Weight:
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QC
Uniprot ID:
P02747
Molecular Weight:
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
Gene Name:
FCGR3A
Uniprot ID:
P08637
Molecular Weight:
29088.895 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type endopeptidase activity
Specific Function:
C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activate C2 and C4.
Gene Name:
C1S
Uniprot ID:
P09871
Molecular Weight:
76683.905 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Receptor signaling protein activity
Specific Function:
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name:
FCGR1A
Uniprot ID:
P12314
Molecular Weight:
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.
Gene Name:
FCGR2A
Uniprot ID:
P12318
Molecular Weight:
35000.42 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells ...
Gene Name:
FCGR2B
Uniprot ID:
P31994
Molecular Weight:
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Transmembrane signaling receptor activity
Specific Function:
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.
Gene Name:
FCGR2C
Uniprot ID:
P31995
Molecular Weight:
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23