Adalimumab

Identification

Name
Adalimumab
Accession Number
DB00051  (BTD00049, BIOD00049)
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Adalimumab is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system. It consists of 1330 amino acids and has a molecular weight of approximately 148 kilodaltons [3].

Protein structure
Db00051
Protein chemical formula
C6428H9912N1694O1987S46
Protein average weight
144190.3 Da
Sequences
> Adalimumab Light chain:
DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPS
RFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
> Adalimumab Heavy chain:
EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDY
ADSVEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Download FASTA Format
Synonyms
  • Adalimumab (genetical recombination)
  • adalimumab-adaz
  • adalimumab-adbm
  • adalimumab-atto
External IDs
ABP-501 / BCD-057 / BI-695501 / BI695501 / CHS-1420 / D2E7 / GP-2017 / GP2017 / LU-200134 / LU200134 / M-923 / M923 / MSB-11022 / MSB11022 / ONS-3010 / SB-5 / SB5
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
HumiraInjection, solution40 mgSubcutaneousAbb Vie Deutschland Gmb H & Co. Kg2003-09-08Not applicableEu
HumiraInjection, solution40 mgSubcutaneousAbb Vie Deutschland Gmb H & Co. Kg2003-09-08Not applicableEu
HumiraInjection, solution40 mgSubcutaneousAbb Vie Deutschland Gmb H & Co. Kg2003-09-08Not applicableEu
HumiraInjection, solution40 mgSubcutaneousAbb Vie Deutschland Gmb H & Co. Kg2003-09-08Not applicableEu
HumiraInjection, solution40 mgSubcutaneousAbb Vie Deutschland Gmb H & Co. Kg2003-09-08Not applicableEu
HumiraSolution20 mgSubcutaneousAbbvieNot applicableNot applicableCanada
HumiraInjection, solution40 mgSubcutaneousAbb Vie Deutschland Gmb H & Co. Kg2003-09-08Not applicableEu
HumiraSolution40 mgSubcutaneousAbbvie2004-09-24Not applicableCanada
HumiraInjection, solution40 mgSubcutaneousAbb Vie Deutschland Gmb H & Co. Kg2003-09-08Not applicableEu
HumiraSolution40 mgSubcutaneousAbbvie2016-11-14Not applicableCanada
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing End
HumiraAdalimumab (40 mg/0.8mL) + Isopropyl Alcohol (0.70 mL/1mL)KitAbbVie Inc.2006-06-23Not applicableUs
HumiraAdalimumab (40 mg/0.8mL) + Isopropyl Alcohol (0.70 mL/1mL)KitA-S Medication Solutions2006-06-23Not applicableUs
HumiraAdalimumab (20 mg/0.2mL) + Isopropyl Alcohol (0.70 mL/1mL)KitAbbVie Inc.2017-04-28Not applicableUs
HumiraAdalimumab (80 mg/0.8mL) + Adalimumab (40 mg/0.4mL) + Isopropyl Alcohol (0.7 mL/1mL)KitAbbVie Inc.2017-04-21Not applicableUs
HumiraAdalimumab (80 mg/0.8mL) + Adalimumab (40 mg/0.4mL) + Isopropyl Alcohol (0.70 mL/1mL)KitAbbVie Inc.2016-10-17Not applicableUs
HumiraAdalimumab (40 mg/0.4mL) + Isopropyl Alcohol (.70 mL/1mL)KitAbbVie Inc.2015-11-23Not applicableUs
HumiraAdalimumab (10 mg/0.2mL) + Isopropyl Alcohol (0.70 mL/1mL)KitAbbVie Inc.2014-09-23Not applicableUs
HumiraAdalimumab (80 mg/0.8mL) + Isopropyl Alcohol (0.70 mL/1mL)KitAbbVie Inc.2017-04-21Not applicableUs
HumiraAdalimumab (80 mg/0.8mL) + Adalimumab (40 mg/0.4mL) + Isopropyl Alcohol (0.70 mL/1mL)KitAbbVie Inc.2016-10-17Not applicableUs
HumiraAdalimumab (20 mg/0.4mL) + Isopropyl Alcohol (0.70 mL/1mL)KitAbbVie Inc.2008-02-21Not applicableUs
International/Other Brands
Amjevita (Amgen, Inc.) / Cyltezo (Boehringer Ingelheim Pharmaceuticals, Inc.) / Humira Pen (Abbott Laboratories)
Categories
UNII
FYS6T7F842
CAS number
331731-18-1

Pharmacology

Indication

For treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.

Associated Conditions
Pharmacodynamics

Used in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.

Mechanism of action

Adalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.

TargetActionsOrganism
ATumor necrosis factor
antibody
Human
ULow affinity immunoglobulin gamma Fc region receptor III-BNot AvailableHuman
UComplement C1r subcomponentNot AvailableHuman
UComplement C1q subcomponent subunit ANot AvailableHuman
UComplement C1q subcomponent subunit BNot AvailableHuman
UComplement C1q subcomponent subunit CNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor III-ANot AvailableHuman
UComplement C1s subcomponentNot AvailableHuman
UHigh affinity immunoglobulin gamma Fc receptor INot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-aNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-bNot AvailableHuman
ULow affinity immunoglobulin gamma Fc region receptor II-cNot AvailableHuman
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system.

Route of elimination
Not Available
Half life

10-20 days.

Clearance
  • 12 mL/hr [RA patients with dose 0.25-10 mg/kg]
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteraction
2-MethoxyethanolThe risk or severity of adverse effects can be increased when Adalimumab is combined with 2-Methoxyethanol.
3-isobutyl-1-methyl-7H-xanthineThe serum concentration of 3-isobutyl-1-methyl-7H-xanthine can be decreased when it is combined with Adalimumab.
6-O-benzylguanineThe serum concentration of 6-O-benzylguanine can be decreased when it is combined with Adalimumab.
7-DeazaguanineThe serum concentration of 7-Deazaguanine can be decreased when it is combined with Adalimumab.
7,9-DimethylguanineThe serum concentration of 7,9-Dimethylguanine can be decreased when it is combined with Adalimumab.
8-azaguanineThe serum concentration of 8-azaguanine can be decreased when it is combined with Adalimumab.
8-chlorotheophyllineThe serum concentration of 8-chlorotheophylline can be decreased when it is combined with Adalimumab.
9-(N-methyl-L-isoleucine)-cyclosporin AThe risk or severity of adverse effects can be increased when Adalimumab is combined with 9-(N-methyl-L-isoleucine)-cyclosporin A.
9-DeazaguanineThe serum concentration of 9-Deazaguanine can be decreased when it is combined with Adalimumab.
9-MethylguanineThe serum concentration of 9-Methylguanine can be decreased when it is combined with Adalimumab.
Food Interactions
Not Available

References

General References
  1. Link [Link]
  2. Link [Link]
  3. Patent: Methods related to adalimumab [Link]
External Links
UniProt
P01857
Genbank
J00228
KEGG Drug
D02597
PubChem Substance
46504982
ChEMBL
CHEMBL1201580
Therapeutic Targets Database
DAP000392
PharmGKB
PA10004
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Adalimumab
ATC Codes
L04AB04 — Adalimumab
AHFS Codes
  • 92:36.00 — Disease-modifying Antirheumatic Agents

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0CompletedBasic ScienceInnate Immunity1
1Active Not RecruitingTreatmentHealthy Volunteers1
1CompletedNot AvailableHealthy Volunteers1
1CompletedBasic ScienceBioequivalence / Phase 11
1CompletedBasic ScienceHealthy Volunteers1
1CompletedHealth Services ResearchHealthy Volunteers1
1CompletedOtherHealthy Volunteers2
1CompletedTreatmentGlomerulosclerosis, Focal Segmental1
1CompletedTreatmentHealthy Volunteers4
1CompletedTreatmentPsoriasis1
1CompletedTreatmentRheumatoid Arthritis1
1CompletedTreatmentUlcerative Colitis (UC)1
1Enrolling by InvitationTreatmentHealthy Volunteers1
1Unknown StatusTreatmentRetinopathy, Diabetic / Subfoveal Choroidal Neovascularization / Uveitis1
1WithdrawnTreatmentAnaplastic Thyroid Cancers1
1, 2Active Not RecruitingOtherInjection Site / Pain NOS1
1, 2CompletedTreatmentOsteoarthritis (OA)1
1, 2Not Yet RecruitingTreatmentMucopolysaccharidosis II / Type 1 Mucopolysaccharidosis1
1, 2TerminatedTreatmentPsoriasis1
2Active Not RecruitingTreatmentHidradenitis Suppurativa (HS)1
2CompletedNot AvailableChronic Plaque Psoriasis1
2CompletedOtherRheumatoid Arthritis1
2CompletedTreatmentAge-Related Macular Degeneration (ARMD) / Subfoveal Choroidal Neovascularization1
2CompletedTreatmentArthritis / Psoriatic1
2CompletedTreatmentCrohn's Disease (CD)2
2CompletedTreatmentErosive Osteo-Arthritis1
2CompletedTreatmentGlomerulosclerosis, Focal Segmental1
2CompletedTreatmentHidradenitis Suppurativa (HS)2
2CompletedTreatmentNetherton Syndrome1
2CompletedTreatmentOsteoarthritis (OA)1
2CompletedTreatmentPsoriasis5
2CompletedTreatmentPsoriatic Arthritis1
2CompletedTreatmentRheumatoid Arthritis12
2CompletedTreatmentSarcoidosis1
2CompletedTreatmentSciatica1
2CompletedTreatmentUveitis1
2Not Yet RecruitingTreatmentAutoimmune Diseases / Inflammatory Diseases1
2RecruitingTreatmentAnkylosing Spondylitis (AS)1
2RecruitingTreatmentBiotherapy / Uveitis1
2RecruitingTreatmentDupuytren's Contracture of the Hand (Viking's Disease)1
2RecruitingTreatmentKnee Osteoarthritis (Knee OA)1
2RecruitingTreatmentNon-Infectious Uveitis / Uveitis1
2TerminatedTreatmentRheumatoid Arthritis3
2TerminatedTreatmentSarcoidosis1
2WithdrawnTreatmentAsthma Bronchial1
2WithdrawnTreatmentColitis / Cytokines / Drug Evaluation / Hermanski-Pudlak Syndrome / Lymphocytes1
2WithdrawnTreatmentCutaneous Sarcoidosis / Sarcoidosis1
2WithdrawnTreatmentInflammatory Reaction / Rheumatoid Arthritis1
2WithdrawnTreatmentPyoderma Gangrenosum2
2WithdrawnTreatmentSarcoidosis1
2, 3CompletedTreatmentCrohn's Disease (CD)2
2, 3CompletedTreatmentJuvenile Idiopathic Arthritis (JIA) / Uveitis1
2, 3CompletedTreatmentPsoriasis1
2, 3CompletedTreatmentRheumatoid Arthritis2
2, 3RecruitingTreatmentMucopolysaccharidosis Type I / Mucopolysaccharidosis Type II / Mucopolysaccharidosis Type VI1
2, 3RecruitingTreatmentPsoriasis1
2, 3Unknown StatusTreatmentUveitis1
3Active Not RecruitingTreatmentAdalimumab / Generalized Pustular Psoriasis (GPP) / Japanese1
3Active Not RecruitingTreatmentChronic Plaque Psoriasis / Moderate to Severe Plaque Psoriasis1
3Active Not RecruitingTreatmentCrohn's Disease (CD)1
3Active Not RecruitingTreatmentHidradenitis Suppurativa (HS)1
3Active Not RecruitingTreatmentModerate to Severe Rheumatoid Arthritis1
3Active Not RecruitingTreatmentPsoriasis3
3Active Not RecruitingTreatmentRheumatoid Arthritis4
3Active Not RecruitingTreatmentSpondyloarthritis1
3Active Not RecruitingTreatmentUlcerative Colitis (UC)2
3CompletedTreatmentAS1
3CompletedTreatmentActive Rheumatoid Arthritis1
3CompletedTreatmentAnkylosing Spondylitis (AS)5
3CompletedTreatmentArthritis; Behcet1
3CompletedTreatmentArthritis / Psoriatic1
3CompletedTreatmentChronic Plaque Psoriasis1
3CompletedTreatmentChronic Plaque Psoriasis / Psoriasis1
3CompletedTreatmentCrohn's Disease (CD)16
3CompletedTreatmentCrohn's Disease With Perianal Fistulas1
3CompletedTreatmentEarly Rheumatoid Arthritis2
3CompletedTreatmentEnthesitis Related Arthritis (ERA)1
3CompletedTreatmentGiant Cells Arteritis1
3CompletedTreatmentHidradenitis Suppurativa (HS)3
3CompletedTreatmentInterstitial Cystitis1
3CompletedTreatmentIntestinal Behçet's Disease1
3CompletedTreatmentJuvenile Idiopathic Arthritis (JIA)2
3CompletedTreatmentModerate to Severe Plaque Psoriasis / Psoriasis / Psoriasis Vulgaris (Plaque Psoriasis)1
3CompletedTreatmentNail Psoriasis / Psoriasis Vulgaris (Plaque Psoriasis)1
3CompletedTreatmentPeripheral Spondyloarthritis1
3CompletedTreatmentPouchitis / Ulcerative Colitis (UC)1
3CompletedTreatmentPsoriasis9
3CompletedTreatmentPsoriasis Vulgaris (Plaque Psoriasis)4
3CompletedTreatmentPsoriasis, Arthritic1
3CompletedTreatmentPsoriasis / Psoriatic Arthritis1
3CompletedTreatmentPsoriatic Arthritis3
3CompletedTreatmentRheumatoid Arthritis26
3CompletedTreatmentRheumatoid Arthritis, Juvenile1
3CompletedTreatmentSpondyloarthritis, Axial2
3CompletedTreatmentUlcerative Colitis (UC)5
3CompletedTreatmentUveitis3
3Enrolling by InvitationTreatmentUlcerative Colitis (UC)1
3RecruitingTreatmentAnkylosing Spondylitis (AS)1
3RecruitingTreatmentCrohn's Disease (CD)3
3RecruitingTreatmentJuvenile Idiopathic Arthritis (JIA)1
3RecruitingTreatmentPsoriasis1
3RecruitingTreatmentPsoriasis Vulgaris (Plaque Psoriasis)1
3RecruitingTreatmentPsoriatic Arthritis2
3RecruitingTreatmentPyoderma Gangrenosum1
3RecruitingTreatmentRheumatoid Arthritis1
3RecruitingTreatmentUlcerative Colitis (UC)3
3TerminatedTreatmentCrohn's Disease (CD) / Mucosal Inflammation1
3TerminatedTreatmentRheumatoid Arthritis2
3Unknown StatusPreventionCrohn's Disease (CD)1
3Unknown StatusTreatmentUlcerative Colitis (UC)1
3WithdrawnTreatmentAnkylosing Spondylitis (AS)1
3WithdrawnTreatmentCrohn's Disease (CD)1
4Active Not RecruitingBasic SciencePsoriasis1
4Active Not RecruitingBasic ScienceRheumatoid Arthritis1
4Active Not RecruitingPreventionCardiovascular Disease (CVD) / Rheumatoid Arthritis1
4Active Not RecruitingTreatmentAnkylosing Spondylitis (AS)1
4Active Not RecruitingTreatmentCrohn's Disease (CD)1
4Active Not RecruitingTreatmentPsoriatic Arthritis1
4Active Not RecruitingTreatmentRheumatoid Arthritis / Targeted Ultrasound1
4Active Not RecruitingTreatmentUlcerative Colitis (UC)1
4CompletedNot AvailableRheumatoid Arthritis3
4CompletedDiagnosticEnterocolitis / Spondyloarthritis1
4CompletedPreventionCoronary Artery Atherosclerosis / Psoriasis / Vascular Inflammation2
4CompletedTreatmentAnkylosing Spondylitis (AS)1
4CompletedTreatmentAnkylosing Spondylitis (AS) / Psoriatic Arthritis / Spondylarthropathy1
4CompletedTreatmentArthritis / Joint Diseases / Rheumatoid Arthritis1
4CompletedTreatmentCardiovascular Disease (CVD) / Psoriasis2
4CompletedTreatmentCrohn's Disease (CD) / Psoriasis Vulgaris (Plaque Psoriasis)1
4CompletedTreatmentModerate to Severe Crohn's Disease1
4CompletedTreatmentModerate to Severe Plaque Psoriasis1
4CompletedTreatmentMusculoskeletal and Connective Tissue Diseases / Rheumatoid Arthritis1
4CompletedTreatmentPsoriasis2
4CompletedTreatmentPsoriasis / Sleep Apnea, Obstructive1
4CompletedTreatmentPsoriatic Arthritis1
4CompletedTreatmentRheumatoid Arthritis14
4CompletedTreatmentSpondyloarthritis1
4CompletedTreatmentSpondyloarthritis, Axial1
4Enrolling by InvitationBasic ScienceRheumatoid Arthritis1
4Not Yet RecruitingTreatmentCrohn's Disease (CD) / Ulcerative Colitis (UC)1
4Not Yet RecruitingTreatmentHidradenitis Suppurativa (HS)1
4Not Yet RecruitingTreatmentMyocardial Inflammation / Myocarditis in RA / Rheumatoid Arthritis1
4RecruitingBasic ScienceRheumatoid Arthritis2
4RecruitingTreatmentAnkylosing Spondylitis (AS)1
4RecruitingTreatmentAnkylosing Spondyloarthritis1
4RecruitingTreatmentCrohn's Disease (CD)2
4RecruitingTreatmentCrohn's Disease (CD) / Inflammatory Bowel Diseases (IBD) / Stricture; Bowel1
4RecruitingTreatmentHidradenitis Suppurativa (HS)1
4RecruitingTreatmentPsoriatic Arthritis1
4RecruitingTreatmentRheumatoid Arthritis7
4TerminatedTreatmentRheumatoid Arthritis4
4Unknown StatusNot AvailableRheumatoid Arthritis1
4Unknown StatusBasic ScienceAbsolute Number, Density of Immune Infiltrate and Dendritic Cells and Inflammatory Cytokines Expression Pattern / Psoriasis, Moderate to Severe1
4Unknown StatusPreventionCardiovascular Disease (CVD) / Psoriasis / Type 2 Diabetes Mellitus1
4Unknown StatusScreeningAnkylosing Spondylitis (AS) / Rheumatoid Arthritis1
4Unknown StatusTreatmentAnkylosing Spondylitis (AS) / High Blood Pressure (Hypertension) / Psoriatic Arthritis / Rheumatoid Arthritis1
4Unknown StatusTreatmentArthritis / Rheumatoid Arthritis1
4Unknown StatusTreatmentRheumatoid Arthritis3
4Unknown StatusTreatmentSpondyloarthritis1
4WithdrawnTreatmentCrohn's Disease (CD) / Spondyloarthritis1
Not AvailableActive Not RecruitingNot AvailableCrohn's Disease (CD) / Inflammatory Bowel Diseases (IBD)1
Not AvailableActive Not RecruitingNot AvailableHidradenitis Suppurativa (HS)1
Not AvailableActive Not RecruitingNot AvailableJIA / Juvenile Idiopathic Arthritis (JIA)1
Not AvailableApproved for MarketingNot AvailableRheumatoid Arthritis3
Not AvailableCompletedNot AvailableAnkylosing Spondylitis (AS) / Psoriatic Arthritis / Rheumatoid Arthritis1
Not AvailableCompletedNot AvailableAtherosclerosis / Atopic Dermatitis (AD) / Psoriasis1
Not AvailableCompletedNot AvailableCrohn's Disease (CD) / Inflammatory Bowel Diseases (IBD) / Ulcerative Colitis (UC)1
Not AvailableCompletedNot AvailableInflammatory Bowel Diseases (IBD)1
Not AvailableCompletedNot AvailableInflammatory Bowel Diseases (IBD) / Psoriasis1
Not AvailableCompletedNot AvailableInflammatory Reaction / Psoriasis1
Not AvailableCompletedNot AvailablePsoriasis1
Not AvailableCompletedNot AvailablePsoriatic Arthritis1
Not AvailableCompletedNot AvailablePsoriatic Arthritis / Rheumatoid Arthritis / Spondyloarthritis1
Not AvailableCompletedNot AvailableRheumatoid Arthritis3
Not AvailableCompletedNot AvailableSpondyloarthritis / Ultrasonography1
Not AvailableCompletedBasic ScienceRheumatoid Arthritis1
Not AvailableCompletedOtherCrohn's Disease (CD)1
Not AvailableCompletedTreatmentPsoriasis1
Not AvailableCompletedTreatmentRheumatoid Arthritis1
Not AvailableNot Yet RecruitingNot AvailableCrohn's Disease (CD)1
Not AvailableRecruitingNot AvailableAnkylosing Spondylitis (AS) / Psoriatic Arthritis / Rheumatoid Arthritis1
Not AvailableRecruitingNot AvailableCrohn's Disease (CD)2
Not AvailableRecruitingNot AvailablePsoriasis1
Not AvailableRecruitingNot AvailableRheumatoid Arthritis4
Not AvailableRecruitingBasic SciencePain NOS / Rheumatoid Arthritis / Tiredness1
Not AvailableRecruitingScreeningAnkylosing Spondylitis (AS)1
Not AvailableRecruitingTreatmentCrohn's Disease (CD) / Drug Monitoring / Inflammatory Bowel Diseases (IBD)1
Not AvailableRecruitingTreatmentUlcerative Colitis (UC)1
Not AvailableUnknown StatusNot AvailableCrohn's Disease (CD)1
Not AvailableUnknown StatusNot AvailableScleritis / Uveitis1
Not AvailableUnknown StatusTreatmentCrohn's Disease (CD)1
Not AvailableUnknown StatusTreatmentPsoriasis1
Not AvailableWithdrawnNot AvailablePsoriatic Arthritis1
Not AvailableWithdrawnNot AvailableRheumatoid Arthritis1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • Abbott Laboratories Ltd.
  • Vetter Pharma Fertigung GmbH and Co. KG
Dosage forms
FormRouteStrength
Injection, solutionSubcutaneous40 mg
Injection, solutionSubcutaneous40 mg/0.8mL
Kit
SolutionSubcutaneous10 mg
SolutionSubcutaneous20 mg
SolutionSubcutaneous40 mg
SolutionSubcutaneous80 mg
Prices
Unit descriptionCostUnit
Humira (1 Box = Two 40 mg/0.8ml Syringes) Box1995.1USD box
Humira 2 20 mg/0.4ml Kit 1 Box = Two 20 mg/0.4ml Syringes1995.1USD box
Humira Pen 2 40 mg/0.8ml Kit (1 Box = 1 Kit Containing Two 40 mg/0.8ml Pens)1995.1USD box
Humira 20 mg/0.4 ml syringe959.19USD syringe
Humira 40 mg/0.8 ml pen959.19USD pen
Humira crohn's starter pack959.19USD each
Humira psoriasis starter pack959.19USD each
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2243459No2002-09-172017-02-10Canada

Properties

State
Liquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.441Not Available
isoelectric point8.25Not Available

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antibody
General Function
Tumor necrosis factor receptor binding
Specific Function
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct ac...
Gene Name
TNF
Uniprot ID
P01375
Uniprot Name
Tumor necrosis factor
Molecular Weight
25644.15 Da
References
  1. Lorenz HM: Technology evaluation: adalimumab, Abbott laboratories. Curr Opin Mol Ther. 2002 Apr;4(2):185-90. [PubMed:12044041]
  2. Flendrie M, Creemers MC, Welsing PM, den Broeder AA, van Riel PL: Survival during treatment with tumour necrosis factor blocking agents in rheumatoid arthritis. Ann Rheum Dis. 2003 Nov;62 Suppl 2:ii30-3. [PubMed:14532145]
  3. Aguillon JC, Contreras J, Dotte A, Cruzat A, Catalan D, Salazar L, Molina MC, Guerrero J, Lopez M, Soto L, Salazar-Onfray F, Cuchacovich M: [New immunological weapons for medicine in the 21st Century: biological therapy based on the use of the latest generation monoclonal antibodies]. Rev Med Chil. 2003 Dec;131(12):1445-53. [PubMed:15022409]
  4. Bang LM, Keating GM: Adalimumab: a review of its use in rheumatoid arthritis. BioDrugs. 2004;18(2):121-39. [PubMed:15046527]
  5. Klinkhoff A: Biological agents for rheumatoid arthritis: targeting both physical function and structural damage. Drugs. 2004;64(12):1267-83. [PubMed:15200343]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent...
Gene Name
FCGR3B
Uniprot ID
O75015
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-B
Molecular Weight
26215.64 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type peptidase activity
Specific Function
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name
C1R
Uniprot ID
P00736
Uniprot Name
Complement C1r subcomponent
Molecular Weight
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QA
Uniprot ID
P02745
Uniprot Name
Complement C1q subcomponent subunit A
Molecular Weight
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QB
Uniprot ID
P02746
Uniprot Name
Complement C1q subcomponent subunit B
Molecular Weight
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proe...
Gene Name
C1QC
Uniprot ID
P02747
Uniprot Name
Complement C1q subcomponent subunit C
Molecular Weight
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as...
Gene Name
FCGR3A
Uniprot ID
P08637
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor III-A
Molecular Weight
29088.895 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Serine-type endopeptidase activity
Specific Function
C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activat...
Gene Name
C1S
Uniprot ID
P09871
Uniprot Name
Complement C1s subcomponent
Molecular Weight
76683.905 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Receptor signaling protein activity
Specific Function
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name
FCGR1A
Uniprot ID
P12314
Uniprot Name
High affinity immunoglobulin gamma Fc receptor I
Molecular Weight
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized ...
Gene Name
FCGR2A
Uniprot ID
P12318
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-a
Molecular Weight
35000.42 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Not Available
Specific Function
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complex...
Gene Name
FCGR2B
Uniprot ID
P31994
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-b
Molecular Weight
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]
Kind
Protein
Organism
Human
Pharmacological action
Unknown
General Function
Transmembrane signaling receptor activity
Specific Function
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulat...
Gene Name
FCGR2C
Uniprot ID
P31995
Uniprot Name
Low affinity immunoglobulin gamma Fc region receptor II-c
Molecular Weight
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423]

Drug created on June 13, 2005 07:24 / Updated on November 14, 2018 12:38