You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on DrugBank.
Identification
NameAdalimumab
Accession NumberDB00051  (BTD00049, BIOD00049)
TypeBiotech
GroupsApproved
DescriptionAdalimumab is a human monoclonal antibody against TNF-alpha. It is produced by recombinant DNA technology using a mammalian cell expression system. It consists of 1330 amino acids and has a molecular weight of approximately 148 kilodaltons.
Protein structureDb00051
Related Articles
Protein chemical formulaC6428H9912N1694O1987S46
Protein average weight144190.3 Da
Sequences
> Light chain:
DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPS
RFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
> Heavy chain:
EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDY
ADSVEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Download FASTA Format
Synonyms
Ig gamma-1 chain C region
External Identifiers Not Available
Approved Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
HumiraInjection, solution40 mgSubcutaneousAbb Vie Ltd2003-09-08Not applicableEu
HumiraKitAbb Vie Inc.2002-12-31Not applicableUs
HumiraInjection, solution40 mgSubcutaneousAbb Vie Ltd2003-09-08Not applicableEu
HumiraInjection, solution40 mgSubcutaneousAbb Vie Ltd2003-09-08Not applicableEu
HumiraInjection, solution40 mgSubcutaneousAbb Vie Ltd2003-09-08Not applicableEu
HumiraKitAbb Vie Inc.2016-10-17Not applicableUs
HumiraInjection, solution40 mg/.8mLSubcutaneousAbb Vie Inc.2002-12-30Not applicableUs
HumiraInjection, solution40 mgSubcutaneousAbb Vie Ltd2003-09-08Not applicableEu
HumiraInjection, solution40 mgSubcutaneousAbb Vie Ltd2003-09-08Not applicableEu
HumiraKitAbb Vie Inc.2002-12-31Not applicableUs
HumiraInjection, solution40 mgSubcutaneousAbb Vie Ltd2003-09-08Not applicableEu
HumiraInjection, solution40 mgSubcutaneousAbb Vie Ltd2003-09-08Not applicableEu
HumiraSolution40 mgSubcutaneousAbbvie Corporation2004-09-24Not applicableCanada
HumiraInjection, solution40 mgSubcutaneousAbb Vie Ltd2003-09-08Not applicableEu
HumiraKitAbb Vie Inc.2002-12-31Not applicableUs
HumiraInjection, solution40 mgSubcutaneousAbb Vie Ltd2003-09-08Not applicableEu
HumiraInjection, solution40 mgSubcutaneousAbb Vie Ltd2003-09-08Not applicableEu
HumiraKitAbb Vie Inc.2016-03-09Not applicableUs
HumiraInjection, solution40 mgSubcutaneousAbb Vie Ltd2003-09-08Not applicableEu
HumiraInjection, solution40 mgSubcutaneousAbb Vie Ltd2003-09-08Not applicableEu
HumiraSolution40 mgSubcutaneousAbbvie Corporation2016-11-14Not applicableCanada
HumiraInjection, solution40 mgSubcutaneousAbb Vie Ltd2003-09-08Not applicableEu
HumiraKitAbb Vie Inc.2002-12-23Not applicableUs
HumiraInjection, solution40 mgSubcutaneousAbb Vie Ltd2003-09-08Not applicableEu
HumiraInjection, solution40 mgSubcutaneousAbb Vie Ltd2003-09-08Not applicableEu
HumiraKitAbb Vie Inc.2016-10-17Not applicableUs
HumiraInjection, solution40 mgSubcutaneousAbb Vie Ltd2003-09-08Not applicableEu
HumiraKitAbb Vie Inc.2002-12-31Not applicableUs
HumiraSolution40 mgSubcutaneousAbbvie Corporation2016-11-14Not applicableCanada
HumiraInjection, solution40 mgSubcutaneousAbb Vie Ltd2003-09-08Not applicableEu
Approved Generic Prescription ProductsNot Available
Approved Over the Counter ProductsNot Available
Unapproved/Other Products Not Available
International Brands
NameCompany
Humira PenAbbott Laboratories
Brand mixturesNot Available
SaltsNot Available
Categories
UNIIFYS6T7F842
CAS number331731-18-1
Pharmacology
IndicationFor treatment of rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, and Crohn's disease.
Structured Indications
PharmacodynamicsUsed in the treatment of immune system mediated diseases, adalimumab binds specifically to TNF-alpha and blocks its general cytokine effects, thereby reducing TNF-induced inflammation and halting tissue destruction.
Mechanism of actionAdalimumab binds to TNF-alpha and blocks its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface TNF expressing cells in vitro in the presence of complement.
TargetKindPharmacological actionActionsOrganismUniProt ID
Tumor necrosis factorProteinyes
antibody
HumanP01375 details
Low affinity immunoglobulin gamma Fc region receptor III-BProteinunknownNot AvailableHumanO75015 details
Complement C1r subcomponentProteinunknownNot AvailableHumanP00736 details
Complement C1q subcomponent subunit AProteinunknownNot AvailableHumanP02745 details
Complement C1q subcomponent subunit BProteinunknownNot AvailableHumanP02746 details
Complement C1q subcomponent subunit CProteinunknownNot AvailableHumanP02747 details
Low affinity immunoglobulin gamma Fc region receptor III-AProteinunknownNot AvailableHumanP08637 details
Complement C1s subcomponentProteinunknownNot AvailableHumanP09871 details
High affinity immunoglobulin gamma Fc receptor IProteinunknownNot AvailableHumanP12314 details
Low affinity immunoglobulin gamma Fc region receptor II-aProteinunknownNot AvailableHumanP12318 details
Low affinity immunoglobulin gamma Fc region receptor II-bProteinunknownNot AvailableHumanP31994 details
Low affinity immunoglobulin gamma Fc region receptor II-cProteinunknownNot AvailableHumanP31995 details
Related Articles
AbsorptionNot Available
Volume of distributionNot Available
Protein bindingNot Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system.

Route of eliminationNot Available
Half life10-20 days.
Clearance
  • 12 mL/hr [RA patients with dose 0.25-10 mg/kg]
ToxicityNot Available
Affected organisms
  • Humans and other mammals
PathwaysNot Available
SNP Mediated EffectsNot Available
SNP Mediated Adverse Drug ReactionsNot Available
Interactions
Drug Interactions
DrugInteractionDrug group
AbataceptThe risk or severity of adverse effects can be increased when Adalimumab is combined with Abatacept.Approved
ALT-110The risk or severity of adverse effects can be increased when Adalimumab is combined with ALT-110.Investigational
Ambroxol acefyllinateThe serum concentration of Ambroxol acefyllinate can be decreased when it is combined with Adalimumab.Experimental
AminophyllineThe serum concentration of Aminophylline can be decreased when it is combined with Adalimumab.Approved
AnakinraThe risk or severity of adverse effects can be increased when Adalimumab is combined with Anakinra.Approved
BcgThe therapeutic efficacy of Bcg can be decreased when used in combination with Adalimumab.Investigational
BelimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Belimumab.Approved
CanakinumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Canakinumab.Approved, Investigational
CDX-110The risk or severity of adverse effects can be increased when Adalimumab is combined with CDX-110.Investigational
Certolizumab pegolAdalimumab may increase the immunosuppressive activities of Certolizumab pegol.Approved
CyclosporineThe serum concentration of Cyclosporine can be decreased when it is combined with Adalimumab.Approved, Investigational, Vet Approved
DenosumabThe risk or severity of adverse effects can be increased when Denosumab is combined with Adalimumab.Approved
DyphyllineThe serum concentration of Dyphylline can be decreased when it is combined with Adalimumab.Approved
EtanerceptThe risk or severity of adverse effects can be increased when Adalimumab is combined with Etanercept.Approved, Investigational
FingolimodAdalimumab may increase the immunosuppressive activities of Fingolimod.Approved, Investigational
G17DTThe risk or severity of adverse effects can be increased when Adalimumab is combined with G17DT.Investigational
GI-5005The risk or severity of adverse effects can be increased when Adalimumab is combined with GI-5005.Investigational
GolimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Golimumab.Approved
InfliximabAdalimumab may increase the immunosuppressive activities of Infliximab.Approved
INGN 201The risk or severity of adverse effects can be increased when Adalimumab is combined with INGN 201.Investigational
INGN 225The risk or severity of adverse effects can be increased when Adalimumab is combined with INGN 225.Investigational
LeflunomideThe risk or severity of adverse effects can be increased when Adalimumab is combined with Leflunomide.Approved, Investigational
NatalizumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Natalizumab.Approved, Investigational
PimecrolimusThe risk or severity of adverse effects can be increased when Pimecrolimus is combined with Adalimumab.Approved, Investigational
Rabies vaccineThe risk or severity of adverse effects can be increased when Adalimumab is combined with Rabies vaccine.Approved
Rabies vaccineThe therapeutic efficacy of Rabies vaccine can be decreased when used in combination with Adalimumab.Approved
RilonaceptThe risk or severity of adverse effects can be increased when Adalimumab is combined with Rilonacept.Approved
RituximabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Rituximab.Approved
RoflumilastRoflumilast may increase the immunosuppressive activities of Adalimumab.Approved
Sipuleucel-TThe therapeutic efficacy of Sipuleucel-T can be decreased when used in combination with Adalimumab.Approved
SRP 299The risk or severity of adverse effects can be increased when Adalimumab is combined with SRP 299.Investigational
TacrolimusThe risk or severity of adverse effects can be increased when Tacrolimus is combined with Adalimumab.Approved, Investigational
TG4010The risk or severity of adverse effects can be increased when Adalimumab is combined with TG4010.Investigational
TheophyllineThe serum concentration of Theophylline can be decreased when it is combined with Adalimumab.Approved
TocilizumabTocilizumab may increase the immunosuppressive activities of Adalimumab.Approved
TofacitinibThe risk or severity of adverse effects can be increased when Adalimumab is combined with Tofacitinib.Approved, Investigational
TrastuzumabTrastuzumab may increase the neutropenic activities of Adalimumab.Approved, Investigational
VedolizumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Vedolizumab.Approved
WarfarinThe serum concentration of Warfarin can be decreased when it is combined with Adalimumab.Approved
Food InteractionsNot Available
References
Synthesis ReferenceNot Available
General References
  1. Link [Link]
  2. Link [Link]
External Links
ATC CodesL04AB04
AHFS Codes
  • 92:00.00
PDB Entries
FDA labelNot Available
MSDSNot Available
Pharmacoeconomics
ManufacturersNot Available
Packagers
Dosage forms
FormRouteStrength
Injection, solutionSubcutaneous40 mg
Injection, solutionSubcutaneous40 mg/.8mL
Kit
SolutionSubcutaneous40 mg
Prices
Unit descriptionCostUnit
Humira (1 Box = Two 40 mg/0.8ml Syringes) Box1995.1USD box
Humira 2 20 mg/0.4ml Kit 1 Box = Two 20 mg/0.4ml Syringes1995.1USD box
Humira Pen 2 40 mg/0.8ml Kit (1 Box = 1 Kit Containing Two 40 mg/0.8ml Pens)1995.1USD box
Humira 20 mg/0.4 ml syringe959.19USD syringe
Humira 40 mg/0.8 ml pen959.19USD pen
Humira crohn's starter pack959.19USD each
Humira psoriasis starter pack959.19USD each
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2243459 No2002-09-172017-02-10Canada
Properties
StateLiquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.441Not Available
isoelectric point8.25Not Available
Taxonomy
DescriptionNot Available
KingdomOrganic Compounds
Super ClassOrganic Acids
ClassCarboxylic Acids and Derivatives
Sub ClassAmino Acids, Peptides, and Analogues
Direct ParentPeptides
Alternative ParentsNot Available
SubstituentsNot Available
Molecular FrameworkNot Available
External DescriptorsNot Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
yes
Actions
antibody
General Function:
Tumor necrosis factor receptor binding
Specific Function:
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Impairs ...
Gene Name:
TNF
Uniprot ID:
P01375
Molecular Weight:
25644.15 Da
References
  1. Lorenz HM: Technology evaluation: adalimumab, Abbott laboratories. Curr Opin Mol Ther. 2002 Apr;4(2):185-90. [PubMed:12044041 ]
  2. Flendrie M, Creemers MC, Welsing PM, den Broeder AA, van Riel PL: Survival during treatment with tumour necrosis factor blocking agents in rheumatoid arthritis. Ann Rheum Dis. 2003 Nov;62 Suppl 2:ii30-3. [PubMed:14532145 ]
  3. Aguillon JC, Contreras J, Dotte A, Cruzat A, Catalan D, Salazar L, Molina MC, Guerrero J, Lopez M, Soto L, Salazar-Onfray F, Cuchacovich M: [New immunological weapons for medicine in the 21st Century: biological therapy based on the use of the latest generation monoclonal antibodies]. Rev Med Chil. 2003 Dec;131(12):1445-53. [PubMed:15022409 ]
  4. Bang LM, Keating GM: Adalimumab: a review of its use in rheumatoid arthritis. BioDrugs. 2004;18(2):121-39. [PubMed:15046527 ]
  5. Klinkhoff A: Biological agents for rheumatoid arthritis: targeting both physical function and structural damage. Drugs. 2004;64(12):1267-83. [PubMed:15200343 ]
  6. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Gene Name:
FCGR3B
Uniprot ID:
O75015
Molecular Weight:
26215.64 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type peptidase activity
Specific Function:
C1r B chain is a serine protease that combines with C1q and C1s to form C1, the first component of the classical pathway of the complement system.
Gene Name:
C1R
Uniprot ID:
P00736
Molecular Weight:
80118.04 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QA
Uniprot ID:
P02745
Molecular Weight:
26016.47 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QB
Uniprot ID:
P02746
Molecular Weight:
26721.62 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2+)-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
Gene Name:
C1QC
Uniprot ID:
P02747
Molecular Weight:
25773.56 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
Gene Name:
FCGR3A
Uniprot ID:
P08637
Molecular Weight:
29088.895 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Serine-type endopeptidase activity
Specific Function:
C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activate C2 and C4.
Gene Name:
C1S
Uniprot ID:
P09871
Molecular Weight:
76683.905 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Receptor signaling protein activity
Specific Function:
High affinity receptor for the Fc region of immunoglobulins gamma. Functions in both innate and adaptive immune responses.
Gene Name:
FCGR1A
Uniprot ID:
P12314
Molecular Weight:
42631.525 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.
Gene Name:
FCGR2A
Uniprot ID:
P12318
Molecular Weight:
35000.42 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Not Available
Specific Function:
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells ...
Gene Name:
FCGR2B
Uniprot ID:
P31994
Molecular Weight:
34043.355 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Kind
Protein
Organism
Human
Pharmacological action
unknown
General Function:
Transmembrane signaling receptor activity
Specific Function:
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells.
Gene Name:
FCGR2C
Uniprot ID:
P31995
Molecular Weight:
35577.96 Da
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [PubMed:17139284 ]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [PubMed:17016423 ]
Comments
comments powered by Disqus
Drug created on June 13, 2005 07:24 / Updated on August 17, 2016 12:23