Adalimumab

Identification

Name
Adalimumab
Accession Number
DB00051  (BTD00049, BIOD00049)
Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Description

Adalimumab is a subcutaneously administered biological disease modifier for the treatment of rheumatoid arthritis and other chronic debilitating diseases mediated by tumor necrosis factor [2], [3]. It was originally launched by Abbvie in the U.S. and approved in 2002 by the FDA [1]. This drug is frequently known as Humira. It is produced by recombinant DNA technology using a mammalian cell expression system. This drug is available in a prefilled syringe form and convenient pen form for subcutaneous self-administered doses [1]. A new biosimilar to adalimumab, named adalimumab-adaz, was approved by the FDA on October 31, 2018. This biosimilar is known as Hyrimoz, and is a trademark of Novartis AG [9].

Protein structure
Db00051
Protein chemical formula
C6428H9912N1694O1987S46
Protein average weight
144190.3 Da
Sequences
> Adalimumab Light chain:
DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPS
RFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
> Adalimumab Heavy chain:
EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDY
ADSVEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLG
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY
NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR
WQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Download FASTA Format
Synonyms
  • Adalimumab (genetical recombination)
  • adalimumab-adaz
  • adalimumab-adbm
  • adalimumab-atto
External IDs
ABP-501 / BCD-057 / BI-695501 / BI695501 / CHS-1420 / D2E7 / GP-2017 / GP2017 / LU-200134 / LU200134 / M-923 / M923 / MSB-11022 / MSB11022 / ONS-3010 / SB-5 / SB5
Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing End
HumiraInjection, solution40 mgSubcutaneousAbb Vie Deutschland Gmb H & Co. Kg2003-09-08Not applicableEu
HumiraInjection, solution40 mgSubcutaneousAbb Vie Deutschland Gmb H & Co. Kg2003-09-08Not applicableEu
HumiraSolution20 mgSubcutaneousAbbvieNot applicableNot applicableCanada
HumiraSolution40 mgSubcutaneousAbbvie2016-11-14Not applicableCanada
HumiraInjection, solution40 mgSubcutaneousAbb Vie Deutschland Gmb H & Co. Kg2003-09-08Not applicableEu
HumiraInjection, solution40 mgSubcutaneousAbb Vie Deutschland Gmb H & Co. Kg2003-09-08Not applicableEu
HumiraInjection, solution40 mgSubcutaneousAbb Vie Deutschland Gmb H & Co. Kg2003-09-08Not applicableEu
HumiraSolution80 mgSubcutaneousAbbvieNot applicableNot applicableCanada
HumiraInjection, solution40 mgSubcutaneousAbb Vie Deutschland Gmb H & Co. Kg2003-09-08Not applicableEu
HumiraInjection, solution40 mgSubcutaneousAbb Vie Deutschland Gmb H & Co. Kg2003-09-08Not applicableEu
Mixture Products
NameIngredientsDosageRouteLabellerMarketing StartMarketing End
HumiraAdalimumab (40 mg/0.4mL) + Isopropyl Alcohol (0.70 mL/1mL)KitAbbVie Inc.2016-03-09Not applicableUs
HumiraAdalimumab (80 mg/0.8mL) + Adalimumab (40 mg/0.4mL) + Isopropyl Alcohol (0.7 mL/1mL)KitAbbVie Inc.2017-04-21Not applicableUs
HumiraAdalimumab (40 mg/0.8mL) + Isopropyl Alcohol (0.70 mL/1mL)KitA-S Medication Solutions2006-06-23Not applicableUs
HumiraAdalimumab (80 mg/0.8mL) + Adalimumab (40 mg/0.4mL) + Isopropyl Alcohol (0.70 mL/1mL)KitAbbVie Inc.2016-10-17Not applicableUs
HumiraAdalimumab (10 mg/0.1mL) + Isopropyl Alcohol (0.7 mL/1mL)KitAbbVie Inc.2017-04-28Not applicableUs
HumiraAdalimumab (10 mg/0.2mL) + Isopropyl Alcohol (0.70 mL/1mL)KitAbbVie Inc.2014-09-23Not applicableUs
HumiraAdalimumab (80 mg/0.8mL) + Isopropyl Alcohol (0.70 mL/1mL)KitAbbVie Inc.2017-04-21Not applicableUs
HumiraAdalimumab (20 mg/0.4mL) + Isopropyl Alcohol (0.70 mL/1mL)KitAbbVie Inc.2008-02-21Not applicableUs
HumiraAdalimumab (20 mg/0.2mL) + Isopropyl Alcohol (0.70 mL/1mL)KitAbbVie Inc.2017-04-28Not applicableUs
HumiraAdalimumab (40 mg/0.8mL) + Isopropyl Alcohol (0.70 mL/1mL)KitAbbVie Inc.2002-12-31Not applicableUs
International/Other Brands
Amjevita (Amgen, Inc.) / Cyltezo (Boehringer Ingelheim Pharmaceuticals, Inc.) / Humira Pen (Abbott Laboratories)
Categories
UNII
FYS6T7F842
CAS number
331731-18-1

Pharmacology

Indication

The following are conditions for which adalimumab has been indicated [12], [Label], [10], [5], [6], [11].

Rheumatoid Arthritis (Moderate to Severe)

Juvenile Idiopathic Arthritis (Moderately to Severely Active)

Psoriatic Arthritis (Active)

Ankylosing Spondylitis (Active)

Crohn’s Disease (Moderately to Severely Active)

Ulcerative Colitis (Moderately to Severely Active)

Plaque Psoriasis (Moderate to Severe Chronic)

Non-infectious Intermediate, Posterior and Panuveitis

Hidradenitis Suppurativa (Moderate to Severe)

Pyoderma Gangrenosum (off-label)

Associated Conditions
Pharmacodynamics

After treatment with adalimumab, a decrease in levels of acute phase reactant proteins of inflammation (C­ reactive protein [CRP] and erythrocyte sedimentation rate [ESR]) and serum cytokines (IL-6) was measured compared to baseline in patients diagnosed with rheumatoid arthritis. A decrease in CRP levels was also observed in patients diagnosed with Crohn’s disease. Serum levels of matrix metalloproteinases (MMP-1 and MMP-3) that lead to the tissue remodeling responsible for cartilage destruction were also found to be decreased after administration of adalimumab [12], [Label]. A reduction in signs and symptoms of disease, the induction of a clinical response, an inhibition of structural damage, and improvements in physical function in adult and pediatric patients with various inflammatory conditions have been demonstrated [1], [3], [Label].

Mechanism of action

Adalimumab binds with specificity to tumor necrosis factor-alpha (TNF-alpha) [2], [3] and inhibits its interaction with the p55 and p75 cell surface TNF receptors. Adalimumab also lyses surface tumor necrosis factor expressing cells in vitro when in the presence of complement. Adalimumab does not bind or inactivate lymphotoxin (Tumor necrosis factor-beta). TNF is a naturally occurring cytokine that plays a role in normal inflammatory and immune responses [3]. Increased levels of TNF are found in the joint synovial fluid of rheumatoid arthritis, psoriatic arthritis, and ankylosing spondylitis patients, and play an imperative role in pathologic inflammation and the joint destruction that are major complications of these diseases. Increased levels of TNF are also measured in psoriasis plaques. In plaque psoriasis, treatment with adalimumab may decrease the epidermal thickness and inflammatory cell infiltration. The relationship between these pharmacodynamics and the mechanism(s) by which adalimumab achieves its clinical effects is not known. Additionally, adalimumab alters biological responses that are induced/regulated by TNF, including changes in the levels of adhesion molecules responsible for leukocyte migration during inflammation (ELAM-1, VCAM-1, and ICAM-1 with an IC50 of 1-2 X 10-10M) [12].

TargetActionsOrganism
ATumor necrosis factor
antibody
Human
Absorption

The maximum serum concentration (Cmax) and the time to reach the maximum concentration (Tmax) were 4.7 ± 1.6 μg/mL and 131 ± 56 hours respectively, following a single 40 mg subcutaneous administration of adalimumab to healthy adult subjects. The average absolute bioavailability of adalimumab estimated from three clinical studies after a single 40 mg subcutaneous dose of adalimumab was 64%. The pharmacokinetics of adalimumab showed a linear pattern over the dose range of 0.5 to 10.0 mg/kg following a single intravenous dose [12].

Volume of distribution

The distribution volume (Vss) ranged from 4.7-6.0 L [12]. Adalimumab concentrations in the synovial fluid from five rheumatoid arthritis patients ranged from 31-96% of those in serum [12].

Protein binding
Not Available
Metabolism

Most likely removed by opsonization via the reticuloendothelial system [A400006].

Route of elimination
Not Available
Half life

The mean terminal half-life was approximately 2 weeks, ranging from 10 to 20 days across studies [12].

Clearance

12 mL/hr [RA patients with dose 0.25-10 mg/kg] [12]. Population pharmacokinetic analyses in patients with rheumatoid arthritis showed a trend toward a higher apparent clearance of adalimumab in the presence of anti-adalimumab antibodies, and a lower clearance with increasing age in patients aged 40 years old to greater than 75 years old [12].

Toxicity

Carcinogenesis, Mutagenesis, Impairment of Fertility

Long-term animal studies of adalimumab products have not been performed to study the carcinogenic potential or the drug's effect on fertility [12].

Refer to the "Adverse Effects" section for more information on adverse effects and "Blackbox Warnings" section for important black box information/warnings.

Rare side effects include: worsening or initiation of congestive heart failure, a lupus-like syndrome, lymphoma, medically significant cytopenias, and worsening or initiation of multiple sclerosis/neurological diseases. There has been reported pancytopenia and increased liver transaminases with the use of adalimumab, which suggests that laboratory value monitoring blood counts and liver function, at least intermittently, are important [4].

Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
DrugInteraction
(R)-warfarinThe metabolism of (R)-warfarin can be increased when combined with Adalimumab.
(S)-WarfarinThe metabolism of (S)-Warfarin can be increased when combined with Adalimumab.
2-MethoxyethanolThe risk or severity of adverse effects can be increased when Adalimumab is combined with 2-Methoxyethanol.
3-isobutyl-1-methyl-7H-xanthineThe serum concentration of 3-isobutyl-1-methyl-7H-xanthine can be decreased when it is combined with Adalimumab.
3,5-diiodothyropropionic acidThe metabolism of 3,5-diiodothyropropionic acid can be increased when combined with Adalimumab.
4-hydroxycoumarinThe metabolism of 4-hydroxycoumarin can be increased when combined with Adalimumab.
4-MethoxyamphetamineThe metabolism of 4-Methoxyamphetamine can be increased when combined with Adalimumab.
5-androstenedioneThe metabolism of 5-androstenedione can be increased when combined with Adalimumab.
6-O-benzylguanineThe serum concentration of 6-O-benzylguanine can be decreased when it is combined with Adalimumab.
7-DeazaguanineThe serum concentration of 7-Deazaguanine can be decreased when it is combined with Adalimumab.
Food Interactions
Not Available

References

General References
  1. Kivitz A, Segurado OG: HUMIRA pen: a novel autoinjection device for subcutaneous injection of the fully human monoclonal antibody adalimumab. Expert Rev Med Devices. 2007 Mar;4(2):109-16. doi: 10.1586/17434440.4.2.109. [PubMed:17359217]
  2. Mease PJ: Adalimumab in the treatment of arthritis. Ther Clin Risk Manag. 2007 Mar;3(1):133-48. [PubMed:18360621]
  3. Scheinfeld N: Adalimumab (HUMIRA): a review. J Drugs Dermatol. 2003 Aug;2(4):375-7. [PubMed:12884458]
  4. Scheinfeld N: Adalimumab: a review of side effects. Expert Opin Drug Saf. 2005 Jul;4(4):637-41. doi: 10.1517/14740338.4.4.637. [PubMed:16011443]
  5. Fonder MA, Cummins DL, Ehst BD, Anhalt GJ, Meyerle JH: Adalimumab therapy for recalcitrant pyoderma gangrenosum. J Burns Wounds. 2006 Nov 20;5:e8. [PubMed:17149453]
  6. Hinterberger L, Muller CS, Vogt T, Pfohler C: Adalimumab: a treatment option for pyoderma gangrenosum after failure of systemic standard therapies. Dermatol Ther (Heidelb). 2012 Dec;2(1):6. doi: 10.1007/s13555-012-0006-6. Epub 2012 May 12. [PubMed:23205329]
  7. Ryman JT, Meibohm B: Pharmacokinetics of Monoclonal Antibodies. CPT Pharmacometrics Syst Pharmacol. 2017 Sep;6(9):576-588. doi: 10.1002/psp4.12224. Epub 2017 Jul 29. [PubMed:28653357]
  8. Patent: Methods related to adalimumab [Link]
  9. Sandoz received US FDA approval for bio similar, Hyrimoz [Link]
  10. HUMIRA website [Link]
  11. Abbvie Website [Link]
  12. HUMIRA FDA LABEL [File]
External Links
UniProt
P01857
Genbank
J00228
KEGG Drug
D02597
PubChem Substance
46504982
ChEMBL
CHEMBL1201580
Therapeutic Targets Database
DAP000392
PharmGKB
PA10004
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Adalimumab
ATC Codes
L04AB04 — Adalimumab
AHFS Codes
  • 92:36.00 — Disease-modifying Antirheumatic Agents
FDA label
Download (3.64 MB)
MSDS
Download (157 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
0CompletedBasic ScienceInnate Immunity1
1Active Not RecruitingTreatmentHealthy Volunteers1
1CompletedNot AvailableHealthy Volunteers1
1CompletedBasic ScienceBioequivalence / Phase 11
1CompletedBasic ScienceHealthy Volunteers1
1CompletedHealth Services ResearchHealthy Volunteers1
1CompletedOtherHealthy Volunteers2
1CompletedTreatmentGlomerulosclerosis, Focal Segmental1
1CompletedTreatmentHealthy Volunteers4
1CompletedTreatmentPsoriasis1
1CompletedTreatmentRheumatoid Arthritis1
1CompletedTreatmentUlcerative Colitis (UC)1
1Enrolling by InvitationTreatmentHealthy Volunteers1
1Unknown StatusTreatmentRetinopathy, Diabetic / Subfoveal Choroidal Neovascularization / Uveitis1
1WithdrawnTreatmentAnaplastic Thyroid Cancers1
1, 2Active Not RecruitingOtherInjection Site / Pain NOS1
1, 2CompletedTreatmentOsteoarthritis (OA)1
1, 2Not Yet RecruitingTreatmentMucopolysaccharidosis II / Type 1 Mucopolysaccharidosis1
1, 2TerminatedTreatmentPsoriasis1
2Active Not RecruitingTreatmentHidradenitis Suppurativa (HS)1
2CompletedNot AvailableChronic Plaque Psoriasis1
2CompletedOtherRheumatoid Arthritis1
2CompletedTreatmentAge-Related Macular Degeneration (ARMD) / Subfoveal Choroidal Neovascularization1
2CompletedTreatmentArthritis / Psoriatic1
2CompletedTreatmentCrohn's Disease (CD)2
2CompletedTreatmentErosive Osteo-Arthritis1
2CompletedTreatmentGlomerulosclerosis, Focal Segmental1
2CompletedTreatmentHidradenitis Suppurativa (HS)2
2CompletedTreatmentNetherton Syndrome1
2CompletedTreatmentOsteoarthritis (OA)1
2CompletedTreatmentPsoriasis5
2CompletedTreatmentPsoriatic Arthritis1
2CompletedTreatmentRheumatoid Arthritis12
2CompletedTreatmentSarcoidosis1
2CompletedTreatmentSciatica1
2CompletedTreatmentUveitis1
2Not Yet RecruitingTreatmentAutoimmune Diseases / Inflammatory Diseases1
2RecruitingTreatmentAnkylosing Spondylitis (AS)1
2RecruitingTreatmentBiotherapy / Uveitis1
2RecruitingTreatmentDupuytren's Contracture of the Hand (Viking's Disease)1
2RecruitingTreatmentKnee Osteoarthritis (Knee OA)1
2RecruitingTreatmentNon-Infectious Uveitis / Uveitis1
2TerminatedTreatmentRheumatoid Arthritis3
2TerminatedTreatmentSarcoidosis1
2WithdrawnTreatmentAsthma Bronchial1
2WithdrawnTreatmentColitis / Cytokines / Drug Evaluation / Hermanski-Pudlak Syndrome / Lymphocytes1
2WithdrawnTreatmentCutaneous Sarcoidosis / Sarcoidosis1
2WithdrawnTreatmentInflammatory Reaction / Rheumatoid Arthritis1
2WithdrawnTreatmentPyoderma Gangrenosum2
2WithdrawnTreatmentSarcoidosis1
2, 3CompletedTreatmentCrohn's Disease (CD)2
2, 3CompletedTreatmentJuvenile Idiopathic Arthritis (JIA) / Uveitis1
2, 3CompletedTreatmentPsoriasis1
2, 3CompletedTreatmentRheumatoid Arthritis2
2, 3RecruitingTreatmentCrohn's Disease (CD) / Inflammatory Bowel Diseases (IBD)1
2, 3RecruitingTreatmentMucopolysaccharidosis Type I / Mucopolysaccharidosis Type II / Mucopolysaccharidosis Type VI1
2, 3RecruitingTreatmentPsoriasis1
2, 3Unknown StatusTreatmentUveitis1
3Active Not RecruitingTreatmentAdalimumab / Generalized Pustular Psoriasis (GPP) / Japanese1
3Active Not RecruitingTreatmentChronic Plaque Psoriasis / Moderate to Severe Plaque Psoriasis1
3Active Not RecruitingTreatmentCrohn's Disease (CD)2
3Active Not RecruitingTreatmentHidradenitis Suppurativa (HS)1
3Active Not RecruitingTreatmentPsoriasis3
3Active Not RecruitingTreatmentRheumatoid Arthritis4
3Active Not RecruitingTreatmentSpondyloarthritis1
3Active Not RecruitingTreatmentUlcerative Colitis (UC)2
3CompletedTreatmentAS1
3CompletedTreatmentActive Rheumatoid Arthritis1
3CompletedTreatmentAnkylosing Spondylitis (AS)5
3CompletedTreatmentArthritis; Behcet1
3CompletedTreatmentArthritis / Psoriatic1
3CompletedTreatmentChronic Plaque Psoriasis1
3CompletedTreatmentChronic Plaque Psoriasis / Psoriasis1
3CompletedTreatmentCrohn's Disease (CD)16
3CompletedTreatmentCrohn's Disease With Perianal Fistulas1
3CompletedTreatmentEarly Rheumatoid Arthritis2
3CompletedTreatmentEnthesitis Related Arthritis (ERA)1
3CompletedTreatmentGiant Cells Arteritis1
3CompletedTreatmentHidradenitis Suppurativa (HS)3
3CompletedTreatmentInterstitial Cystitis1
3CompletedTreatmentIntestinal Behçet's Disease1
3CompletedTreatmentJuvenile Idiopathic Arthritis (JIA)2
3CompletedTreatmentModerate to Severe Plaque Psoriasis / Psoriasis / Psoriasis Vulgaris (Plaque Psoriasis)1
3CompletedTreatmentModerate to Severe Rheumatoid Arthritis1
3CompletedTreatmentNail Psoriasis / Psoriasis Vulgaris (Plaque Psoriasis)1
3CompletedTreatmentPeripheral Spondyloarthritis1
3CompletedTreatmentPouchitis / Ulcerative Colitis (UC)1
3CompletedTreatmentPsoriasis9
3CompletedTreatmentPsoriasis Vulgaris (Plaque Psoriasis)4
3CompletedTreatmentPsoriasis, Arthritic1
3CompletedTreatmentPsoriasis / Psoriatic Arthritis1
3CompletedTreatmentPsoriatic Arthritis3
3CompletedTreatmentRheumatoid Arthritis26
3CompletedTreatmentRheumatoid Arthritis, Juvenile1
3CompletedTreatmentSpondyloarthritis, Axial2
3CompletedTreatmentUlcerative Colitis (UC)5
3CompletedTreatmentUveitis3
3Enrolling by InvitationTreatmentUlcerative Colitis (UC)1
3RecruitingTreatmentAnkylosing Spondylitis (AS)1
3RecruitingTreatmentCrohn's Disease (CD)1
3RecruitingTreatmentJuvenile Idiopathic Arthritis (JIA)1
3RecruitingTreatmentPsoriasis1
3RecruitingTreatmentPsoriasis Vulgaris (Plaque Psoriasis)1
3RecruitingTreatmentPsoriatic Arthritis2
3RecruitingTreatmentPyoderma Gangrenosum1
3RecruitingTreatmentRheumatoid Arthritis1
3RecruitingTreatmentUlcerative Colitis (UC)3
3TerminatedTreatmentCrohn's Disease (CD)1
3TerminatedTreatmentCrohn's Disease (CD) / Mucosal Inflammation1
3TerminatedTreatmentRheumatoid Arthritis2
3Unknown StatusPreventionCrohn's Disease (CD)1
3Unknown StatusTreatmentUlcerative Colitis (UC)1
3WithdrawnTreatmentAnkylosing Spondylitis (AS)1
3WithdrawnTreatmentCrohn's Disease (CD)1
4Active Not RecruitingBasic SciencePsoriasis1
4Active Not RecruitingBasic ScienceRheumatoid Arthritis1
4Active Not RecruitingPreventionCardiovascular Disease (CVD) / Rheumatoid Arthritis1
4Active Not RecruitingTreatmentAnkylosing Spondylitis (AS)1
4Active Not RecruitingTreatmentCrohn's Disease (CD)1
4Active Not RecruitingTreatmentPsoriatic Arthritis1
4Active Not RecruitingTreatmentRheumatoid Arthritis / Targeted Ultrasound1
4Active Not RecruitingTreatmentUlcerative Colitis (UC)1
4CompletedNot AvailableRheumatoid Arthritis3
4CompletedDiagnosticEnterocolitis / Spondyloarthritis1
4CompletedPreventionCoronary Artery Atherosclerosis / Psoriasis / Vascular Inflammation2
4CompletedTreatmentAnkylosing Spondylitis (AS)1
4CompletedTreatmentAnkylosing Spondylitis (AS) / Psoriatic Arthritis / Spondylarthropathy1
4CompletedTreatmentArthritis / Joint Diseases / Rheumatoid Arthritis1
4CompletedTreatmentCardiovascular Disease (CVD) / Psoriasis2
4CompletedTreatmentCrohn's Disease (CD) / Psoriasis Vulgaris (Plaque Psoriasis)1
4CompletedTreatmentModerate to Severe Crohn's Disease1
4CompletedTreatmentModerate to Severe Plaque Psoriasis1
4CompletedTreatmentMusculoskeletal and Connective Tissue Diseases / Rheumatoid Arthritis1
4CompletedTreatmentPsoriasis2
4CompletedTreatmentPsoriasis / Sleep Apnea, Obstructive1
4CompletedTreatmentPsoriatic Arthritis1
4CompletedTreatmentRheumatoid Arthritis14
4CompletedTreatmentSpondyloarthritis1
4CompletedTreatmentSpondyloarthritis, Axial1
4Enrolling by InvitationBasic ScienceRheumatoid Arthritis1
4Not Yet RecruitingTreatmentCrohn's Disease (CD) / Ulcerative Colitis (UC)1
4Not Yet RecruitingTreatmentHidradenitis Suppurativa (HS)1
4Not Yet RecruitingTreatmentMyocardial Inflammation / Myocarditis in RA / Rheumatoid Arthritis1
4Not Yet RecruitingTreatmentPsoriatic Arthritis1
4RecruitingBasic ScienceRheumatoid Arthritis2
4RecruitingTreatmentAnkylosing Spondylitis (AS)1
4RecruitingTreatmentAnkylosing Spondyloarthritis1
4RecruitingTreatmentCrohn's Disease (CD)2
4RecruitingTreatmentCrohn's Disease (CD) / Inflammatory Bowel Diseases (IBD) / Stricture; Bowel1
4RecruitingTreatmentHidradenitis Suppurativa (HS)1
4RecruitingTreatmentPsoriatic Arthritis1
4RecruitingTreatmentRheumatoid Arthritis8
4TerminatedTreatmentRheumatoid Arthritis4
4Unknown StatusNot AvailableRheumatoid Arthritis1
4Unknown StatusBasic ScienceAbsolute Number, Density of Immune Infiltrate and Dendritic Cells and Inflammatory Cytokines Expression Pattern / Psoriasis, Moderate to Severe1
4Unknown StatusPreventionCardiovascular Disease (CVD) / Psoriasis / Type 2 Diabetes Mellitus1
4Unknown StatusScreeningAnkylosing Spondylitis (AS) / Rheumatoid Arthritis1
4Unknown StatusTreatmentAnkylosing Spondylitis (AS) / High Blood Pressure (Hypertension) / Psoriatic Arthritis / Rheumatoid Arthritis1
4Unknown StatusTreatmentArthritis / Rheumatoid Arthritis1
4Unknown StatusTreatmentRheumatoid Arthritis3
4Unknown StatusTreatmentSpondyloarthritis1
4WithdrawnTreatmentCrohn's Disease (CD) / Spondyloarthritis1
Not AvailableActive Not RecruitingNot AvailableCrohn's Disease (CD) / Inflammatory Bowel Diseases (IBD)1
Not AvailableActive Not RecruitingNot AvailableHidradenitis Suppurativa (HS)1
Not AvailableActive Not RecruitingNot AvailableJIA / Juvenile Idiopathic Arthritis (JIA)1
Not AvailableApproved for MarketingNot AvailableRheumatoid Arthritis3
Not AvailableCompletedNot AvailableAnkylosing Spondylitis (AS) / Psoriatic Arthritis / Rheumatoid Arthritis1
Not AvailableCompletedNot AvailableAtherosclerosis / Atopic Dermatitis (AD) / Psoriasis1
Not AvailableCompletedNot AvailableCrohn's Disease (CD) / Inflammatory Bowel Diseases (IBD) / Ulcerative Colitis (UC)1
Not AvailableCompletedNot AvailableInflammatory Bowel Diseases (IBD)1
Not AvailableCompletedNot AvailableInflammatory Bowel Diseases (IBD) / Psoriasis1
Not AvailableCompletedNot AvailableInflammatory Reaction / Psoriasis1
Not AvailableCompletedNot AvailablePsoriasis1
Not AvailableCompletedNot AvailablePsoriatic Arthritis1
Not AvailableCompletedNot AvailablePsoriatic Arthritis / Rheumatoid Arthritis / Spondyloarthritis1
Not AvailableCompletedNot AvailableRheumatoid Arthritis4
Not AvailableCompletedNot AvailableSpondyloarthritis / Ultrasonography1
Not AvailableCompletedBasic ScienceRheumatoid Arthritis1
Not AvailableCompletedOtherCrohn's Disease (CD)1
Not AvailableCompletedTreatmentPsoriasis1
Not AvailableCompletedTreatmentRheumatoid Arthritis1
Not AvailableNot Yet RecruitingNot AvailableCrohn's Disease (CD)1
Not AvailableRecruitingNot AvailableAnkylosing Spondylitis (AS) / Psoriatic Arthritis / Rheumatoid Arthritis1
Not AvailableRecruitingNot AvailableCrohn's Disease (CD)2
Not AvailableRecruitingNot AvailablePsoriasis1
Not AvailableRecruitingNot AvailableRheumatoid Arthritis3
Not AvailableRecruitingBasic SciencePain NOS / Rheumatoid Arthritis / Tiredness1
Not AvailableRecruitingScreeningAnkylosing Spondylitis (AS)1
Not AvailableRecruitingTreatmentCrohn's Disease (CD) / Drug Monitoring / Inflammatory Bowel Diseases (IBD)1
Not AvailableRecruitingTreatmentUlcerative Colitis (UC)1
Not AvailableUnknown StatusNot AvailableCrohn's Disease (CD)1
Not AvailableUnknown StatusNot AvailableScleritis / Uveitis1
Not AvailableUnknown StatusTreatmentCrohn's Disease (CD)1
Not AvailableUnknown StatusTreatmentPsoriasis1
Not AvailableWithdrawnNot AvailablePsoriatic Arthritis1
Not AvailableWithdrawnNot AvailableRheumatoid Arthritis1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • Abbott Laboratories Ltd.
  • Vetter Pharma Fertigung GmbH and Co. KG
Dosage forms
FormRouteStrength
Injection, solutionSubcutaneous40 mg
Injection, solutionSubcutaneous40 mg/0.8mL
Kit
SolutionSubcutaneous10 mg
SolutionSubcutaneous20 mg
SolutionSubcutaneous40 mg
SolutionSubcutaneous80 mg
Prices
Unit descriptionCostUnit
Humira (1 Box = Two 40 mg/0.8ml Syringes) Box1995.1USD box
Humira 2 20 mg/0.4ml Kit 1 Box = Two 20 mg/0.4ml Syringes1995.1USD box
Humira Pen 2 40 mg/0.8ml Kit (1 Box = 1 Kit Containing Two 40 mg/0.8ml Pens)1995.1USD box
Humira 20 mg/0.4 ml syringe959.19USD syringe
Humira 40 mg/0.8 ml pen959.19USD pen
Humira crohn's starter pack959.19USD each
Humira psoriasis starter pack959.19USD each
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)
CA2243459No2002-09-172017-02-10Canada

Properties

State
Liquid
Experimental Properties
PropertyValueSource
isoelectric point8.25http://www.druglib.com/activeingredient/adalimumab/chembio/

Taxonomy

Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Targets

Kind
Protein
Organism
Human
Pharmacological action
Yes
Actions
Antibody
General Function
Tumor necrosis factor receptor binding
Specific Function
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct ac...
Gene Name
TNF
Uniprot ID
P01375
Uniprot Name
Tumor necrosis factor
Molecular Weight
25644.15 Da
References
  1. Lorenz HM: Technology evaluation: adalimumab, Abbott laboratories. Curr Opin Mol Ther. 2002 Apr;4(2):185-90. [PubMed:12044041]
  2. Flendrie M, Creemers MC, Welsing PM, den Broeder AA, van Riel PL: Survival during treatment with tumour necrosis factor blocking agents in rheumatoid arthritis. Ann Rheum Dis. 2003 Nov;62 Suppl 2:ii30-3. [PubMed:14532145]
  3. Aguillon JC, Contreras J, Dotte A, Cruzat A, Catalan D, Salazar L, Molina MC, Guerrero J, Lopez M, Soto L, Salazar-Onfray F, Cuchacovich M: [New immunological weapons for medicine in the 21st Century: biological therapy based on the use of the latest generation monoclonal antibodies]. Rev Med Chil. 2003 Dec;131(12):1445-53. [PubMed:15022409]
  4. Bang LM, Keating GM: Adalimumab: a review of its use in rheumatoid arthritis. BioDrugs. 2004;18(2):121-39. [PubMed:15046527]

Drug created on June 13, 2005 07:24 / Updated on December 18, 2018 09:04